Clone RE41391 Report

Search the DGRC for RE41391

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:413
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG13993-RA
Protein status:RE41391.pep: gold
Preliminary Size:535
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13993 2001-12-14 Blastp of sequenced clone
CG13993 2002-01-01 Sim4 clustering to Release 2
CG13993 2003-01-01 Sim4 clustering to Release 3
CG13993 2008-04-29 Release 5.5 accounting
CG13993 2008-08-15 Release 5.9 accounting
CG13993 2008-12-18 5.12 accounting

Clone Sequence Records

RE41391.complete Sequence

587 bp (587 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071381

> RE41391.complete
AGTAAAGTAGAAAAAAAAAACCATAAGCTTACCGCAGGTGTTGCAATTTT
CAGTGAATTCGCAGCAAAGCCAAGCAATTTGCATTCAATCATCTGTGAAG
GAAAAGCTATCACACAAAATGGCACAAATGGACATCGAATTGAAGAAGGC
CTTCACCGAGATGCAGATCAATAAGCTGGAGACGACCAAGAAGATCCACA
TGATCGACATGAAGTGCGACATGGTCAAGACAGGCAAACAAAAGTACCAG
CTGACAGAAAAGGGCACCAGCAGCTTGGCCGACGACACAAGAGTTTACCA
GTCCGTGGGTCGCATGTTCCTGCTTACCGATGTACAGAATATGCGCGAGG
ACCTGAAGGCTAGGCAGGAGAAATGCGACAAAGCGATAGAACTGCTGGAG
AAGAAGAAGGAGTTCTTGCAGAAGTCCCTTAAGAGCCAGGAAGACGGTCT
GCGCGAGTTGGTGCAGCAGCGCAAGGAAGCCGATCAGACTGCGAAATAGA
CTACAACTCCAAACTGGCATTTATCCCTCAACGCAATTGCTTATTTATTT
TCAATATACTCGTCTAAATCGAAAAAAAAAAAAAAAA

RE41391.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13993-RA 616 CG13993-RA 40..610 3..573 2840 99.8 Plus
CG9154-RA 770 CG9154-RA 720..770 573..523 240 98 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6068608..6068887 290..569 1400 100 Plus
chr2L 23010047 chr2L 6068156..6068302 3..149 735 100 Plus
chr2L 23010047 chr2L 6068396..6068540 147..291 725 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6069557..6069840 290..573 1405 99.6 Plus
2L 23513712 2L 6069105..6069251 3..149 735 100 Plus
2L 23513712 2L 6069345..6069489 147..291 725 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6069557..6069840 290..573 1405 99.6 Plus
2L 23513712 2L 6069105..6069251 3..149 735 100 Plus
2L 23513712 2L 6069345..6069489 147..291 725 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:22:22 has no hits.

RE41391.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:19 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6068154..6068301 1..148 99 -> Plus
chr2L 6068398..6068540 149..291 100 -> Plus
chr2L 6068610..6068889 292..571 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:04 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 119..499 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:44 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 119..499 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:00:11 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 119..499 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:55 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 119..499 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:53 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 119..499 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:47 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..571 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:44 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 25..595 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:00:11 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 25..595 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:55 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..571 1..571 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:53 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 25..595 1..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:19 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6069103..6069250 1..148 99 -> Plus
2L 6069347..6069489 149..291 100 -> Plus
2L 6069559..6069838 292..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:19 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6069103..6069250 1..148 99 -> Plus
2L 6069347..6069489 149..291 100 -> Plus
2L 6069559..6069838 292..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:19 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6069103..6069250 1..148 99 -> Plus
2L 6069347..6069489 149..291 100 -> Plus
2L 6069559..6069838 292..571 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:00:11 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6069103..6069250 1..148 99 -> Plus
arm_2L 6069347..6069489 149..291 100 -> Plus
arm_2L 6069559..6069838 292..571 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:40 Download gff for RE41391.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6069559..6069838 292..571 99   Plus
2L 6069103..6069250 1..148 99 -> Plus
2L 6069347..6069489 149..291 100 -> Plus

RE41391.hyp Sequence

Translation from 118 to 498

> RE41391.hyp
MAQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGT
SSLADDTRVYQSVGRMFLLTDVQNMREDLKARQEKCDKAIELLEKKKEFL
QKSLKSQEDGLRELVQQRKEADQTAK*

RE41391.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13993-PB 126 CG13993-PB 1..126 1..126 629 100 Plus
CG13993-PA 126 CG13993-PA 1..126 1..126 629 100 Plus

RE41391.pep Sequence

Translation from 118 to 498

> RE41391.pep
MAQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGT
SSLADDTRVYQSVGRMFLLTDVQNMREDLKARQEKCDKAIELLEKKKEFL
QKSLKSQEDGLRELVQQRKEADQTAK*

RE41391.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14502-PA 126 GF14502-PA 1..126 1..126 587 91.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23927-PA 126 GG23927-PA 1..126 1..126 601 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10801-PA 126 GH10801-PA 1..126 1..126 569 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Pfdn1-PB 126 CG13993-PB 1..126 1..126 629 100 Plus
Pfdn1-PA 126 CG13993-PA 1..126 1..126 629 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17311-PA 126 GI17311-PA 1..126 1..126 549 86.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19062-PA 126 GL19062-PA 1..126 1..126 560 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12682-PA 126 GA12682-PA 1..126 1..126 560 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18600-PA 126 GM18600-PA 1..126 1..126 623 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23384-PA 126 GD23384-PA 1..126 1..126 627 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15790-PA 126 GJ15790-PA 1..126 1..126 553 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14724-PA 126 GK14724-PA 1..126 1..126 556 86.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25899-PA 126 GE25899-PA 1..126 1..126 604 95.2 Plus