BDGP Sequence Production Resources |
Search the DGRC for RE41391
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 413 |
Well: | 91 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG13993-RA |
Protein status: | RE41391.pep: gold |
Preliminary Size: | 535 |
Sequenced Size: | 587 |
Gene | Date | Evidence |
---|---|---|
CG13993 | 2001-12-14 | Blastp of sequenced clone |
CG13993 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13993 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13993 | 2008-04-29 | Release 5.5 accounting |
CG13993 | 2008-08-15 | Release 5.9 accounting |
CG13993 | 2008-12-18 | 5.12 accounting |
587 bp (587 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071381
> RE41391.complete AGTAAAGTAGAAAAAAAAAACCATAAGCTTACCGCAGGTGTTGCAATTTT CAGTGAATTCGCAGCAAAGCCAAGCAATTTGCATTCAATCATCTGTGAAG GAAAAGCTATCACACAAAATGGCACAAATGGACATCGAATTGAAGAAGGC CTTCACCGAGATGCAGATCAATAAGCTGGAGACGACCAAGAAGATCCACA TGATCGACATGAAGTGCGACATGGTCAAGACAGGCAAACAAAAGTACCAG CTGACAGAAAAGGGCACCAGCAGCTTGGCCGACGACACAAGAGTTTACCA GTCCGTGGGTCGCATGTTCCTGCTTACCGATGTACAGAATATGCGCGAGG ACCTGAAGGCTAGGCAGGAGAAATGCGACAAAGCGATAGAACTGCTGGAG AAGAAGAAGGAGTTCTTGCAGAAGTCCCTTAAGAGCCAGGAAGACGGTCT GCGCGAGTTGGTGCAGCAGCGCAAGGAAGCCGATCAGACTGCGAAATAGA CTACAACTCCAAACTGGCATTTATCCCTCAACGCAATTGCTTATTTATTT TCAATATACTCGTCTAAATCGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 6068608..6068887 | 290..569 | 1400 | 100 | Plus |
chr2L | 23010047 | chr2L | 6068156..6068302 | 3..149 | 735 | 100 | Plus |
chr2L | 23010047 | chr2L | 6068396..6068540 | 147..291 | 725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 6068154..6068301 | 1..148 | 99 | -> | Plus |
chr2L | 6068398..6068540 | 149..291 | 100 | -> | Plus |
chr2L | 6068610..6068889 | 292..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..381 | 119..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..381 | 119..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..381 | 119..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..381 | 119..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..381 | 119..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..571 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 25..595 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 25..595 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 1..571 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13993-RA | 25..595 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6069103..6069250 | 1..148 | 99 | -> | Plus |
2L | 6069347..6069489 | 149..291 | 100 | -> | Plus |
2L | 6069559..6069838 | 292..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6069103..6069250 | 1..148 | 99 | -> | Plus |
2L | 6069347..6069489 | 149..291 | 100 | -> | Plus |
2L | 6069559..6069838 | 292..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6069103..6069250 | 1..148 | 99 | -> | Plus |
2L | 6069347..6069489 | 149..291 | 100 | -> | Plus |
2L | 6069559..6069838 | 292..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 6069103..6069250 | 1..148 | 99 | -> | Plus |
arm_2L | 6069347..6069489 | 149..291 | 100 | -> | Plus |
arm_2L | 6069559..6069838 | 292..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6069559..6069838 | 292..571 | 99 | Plus | |
2L | 6069103..6069250 | 1..148 | 99 | -> | Plus |
2L | 6069347..6069489 | 149..291 | 100 | -> | Plus |
Translation from 118 to 498
> RE41391.hyp MAQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGT SSLADDTRVYQSVGRMFLLTDVQNMREDLKARQEKCDKAIELLEKKKEFL QKSLKSQEDGLRELVQQRKEADQTAK*
Translation from 118 to 498
> RE41391.pep MAQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGT SSLADDTRVYQSVGRMFLLTDVQNMREDLKARQEKCDKAIELLEKKKEFL QKSLKSQEDGLRELVQQRKEADQTAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14502-PA | 126 | GF14502-PA | 1..126 | 1..126 | 587 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23927-PA | 126 | GG23927-PA | 1..126 | 1..126 | 601 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10801-PA | 126 | GH10801-PA | 1..126 | 1..126 | 569 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pfdn1-PB | 126 | CG13993-PB | 1..126 | 1..126 | 629 | 100 | Plus |
Pfdn1-PA | 126 | CG13993-PA | 1..126 | 1..126 | 629 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17311-PA | 126 | GI17311-PA | 1..126 | 1..126 | 549 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19062-PA | 126 | GL19062-PA | 1..126 | 1..126 | 560 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12682-PA | 126 | GA12682-PA | 1..126 | 1..126 | 560 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18600-PA | 126 | GM18600-PA | 1..126 | 1..126 | 623 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23384-PA | 126 | GD23384-PA | 1..126 | 1..126 | 627 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15790-PA | 126 | GJ15790-PA | 1..126 | 1..126 | 553 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14724-PA | 126 | GK14724-PA | 1..126 | 1..126 | 556 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25899-PA | 126 | GE25899-PA | 1..126 | 1..126 | 604 | 95.2 | Plus |