Clone RE41492 Report

Search the DGRC for RE41492

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:414
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG34331-RA
Protein status:RE41492.pep: validated full length
Sequenced Size:620

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12656 2001-12-14 Blastp of sequenced clone
CG12656 2002-01-01 Sim4 clustering to Release 2
CG12656 2003-01-01 Sim4 clustering to Release 3
CG34331 2008-04-29 Release 5.5 accounting
CG34331 2008-08-15 Release 5.9 accounting
CG34331 2008-12-18 5.12 accounting

Clone Sequence Records

RE41492.complete Sequence

620 bp (620 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071382

> RE41492.complete
ATCAGTTGCTTCTTGCTTGCCACCGAGATGAGCGCAATAAAGCCCGCCCT
GCTGCTCTGCCTGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGGG
CGAATCCCGTGGAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAAC
GAACTGGGCATCGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCACT
GGGCATATTCACGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCACT
GCGCCCAGCTCTCGCCACATCACCCACACCACCCCCAGTGCCACAGCTAC
TGCAAACGCCAAGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTCA
GTGCTTTTCCTAGGTCTACTTCGACTGTAAGCCAAAACAGCGTTTTTTTT
TTTCTTTTGTTGAGTGCAGCACAACTATATGACGAAATATGTGCAAATAT
GTTTATCTACCAACTAGTATATATATTAAAACTGGCAATGAACAATGAAA
GCGAATCAAAATTGCTCAAATCATACACATAATATGTAGTCTTTGACCTT
CTAACATGCACTGAATAGAAAAAGCAGAACCTTAATAAATCTTCAAGTTA
AATTCAAAAAAAAAAAAAAA

RE41492.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 605 CG34331-RB 1..605 1..605 3025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20011031..20011635 1..605 2980 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20122457..20123063 1..607 3035 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20130555..20131161 1..607 3035 100 Plus
Blast to na_te.dros performed 2019-03-16 21:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2445..2521 424..501 117 64.6 Plus

RE41492.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:12:44 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20011031..20011635 1..605 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:10 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 52..414 1..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:31 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 28..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:06 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 28..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:41 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 52..414 1..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:10:11 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 28..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:12 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 52..656 1..605 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:30 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..605 1..605 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:06 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 5..609 1..605 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:41 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 52..656 1..605 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:11 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 5..609 1..605 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:44 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122457..20123061 1..605 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:44 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122457..20123061 1..605 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:44 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122457..20123061 1..605 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:06 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20016490..20017094 1..605 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:12 Download gff for RE41492.complete
Subject Subject Range Query Range Percent Splice Strand
X 20130555..20131159 1..605 100   Plus

RE41492.pep Sequence

Translation from 118 to 531

> RE41492.pep
MFPIFPHPMPTNWASISERRKMPPTSHWAYSRSRCATFSRTPPTAPSSRH
ITHTTPSATATANAKVTGWASARRTSVSAFPRSTSTVSQNSVFFFLLLSA
AQLYDEICANMFIYQLVYILKLAMNNESESKLLKSYT*
Sequence RE41492.pep has no blast hits.

RE41492.hyp Sequence

Translation from 118 to 531

> RE41492.hyp
MFPIFPHPMPTNWASISERRKMPPTSHWAYSRSRCATFSRTPPTAPSSRH
ITHTTPSATATANAKVTGWASARRTSVSAFPRSTSTVSQNSVFFFLLLSA
AQLYDEICANMFIYQLVYILKLAMNNESESKLLKSYT*
Sequence RE41492.hyp has no blast hits.