Clone RE42326 Report

Search the DGRC for RE42326

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:423
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCG11151-RA
Protein status:RE42326.pep: gold
Preliminary Size:688
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11151 2001-12-16 Blastp of sequenced clone
CG11151 2002-01-01 Sim4 clustering to Release 2
CG11151 2003-01-01 Sim4 clustering to Release 3
CG11151 2008-04-29 Release 5.5 accounting
CG11151 2008-08-15 Release 5.9 accounting
CG11151 2008-12-18 5.12 accounting

Clone Sequence Records

RE42326.complete Sequence

721 bp (721 high quality bases) assembled on 2001-12-16

GenBank Submission: AY071384

> RE42326.complete
AACTTGCTATACGACCATCCCGCTCCCACACAACAGGGGCAGTGTAGTGA
AAAAAGCGACAATAAAATCGCCGATTGCACGCCTTCTGCTCATTACTTCG
CGTTCCGCTCTCAAAGCAAATACCCCCACAACAACAACAACAACAACCAT
GTCTCTGCAGTCGGACGCCGTTTTCCAAAAGATCATCGATGGACTGAAGG
AGAACGAGGCCAAGGCCAAGGCGGTCAACGGTGTGTTCCTGTACAAAATC
ACCAAGGACGGCAAGGTGGCCAAGGAGTGGACTCTGGACTGCAAGAACGC
CAAGGCCTACGAGGGACCTGCCCAGGGCATCAAGGTGGACACCACCTTGA
CGGTCGCCGACGAGGACATGGTTGACATCGCCCTGGGCAAGCTGAACCCC
CAGGCTGCCTTCATGAAGGGCAAGCTGAAGATCGCCGGCAACATCATGCT
CACCCAGAAGCTGGCGCCGCTCCTGAAGACCGACGCCAAGTTGTAAAAAA
GGAGTGATCAACAATAACCCAGCCCAGTTAGCACATTCCTCAACGAGACA
GTGTGTGTGTGTTCCCTTTTACACAATTTTTTTTTTTTTTCGTGTGTGTA
ATTTGTAATCTGTATTCGTGTTTTTGTTTCACCACATAATTAATGTTATT
TTTGTACGGAAAAACCCGTCTACAAAACTAGAAAATAATACATAAGGCGA
AAACGAAAAAAAAAAAAAAAA

RE42326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-RA 952 CG11151-RA 141..850 1..710 3535 99.8 Plus
CG11151.a 1105 CG11151.a 206..798 118..710 2950 99.8 Plus
CG11151.a 1105 CG11151.a 1..117 1..117 585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13631407..13631830 282..705 2120 100 Plus
chrX 22417052 chrX 13630678..13630841 118..281 820 100 Plus
chrX 22417052 chrX 13630473..13630589 1..117 585 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13740678..13741106 282..710 2130 99.8 Plus
X 23542271 X 13739949..13740112 118..281 820 100 Plus
X 23542271 X 13739744..13739860 1..117 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13748776..13749204 282..710 2130 99.7 Plus
X 23527363 X 13748047..13748210 118..281 820 100 Plus
X 23527363 X 13747842..13747958 1..117 585 100 Plus
Blast to na_te.dros performed 2019-03-16 23:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 694..798 653..556 129 63.8 Minus
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 3564..3597 628..595 125 85.3 Minus
opus 7521 opus OPUS 7521bp 6164..6259 656..558 111 61.8 Minus
gypsy7 5486 gypsy7 GYPSY7 5486bp 5078..5120 567..609 107 72.1 Plus

RE42326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:04:38 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13630473..13630589 1..117 100 == Plus
chrX 13630708..13630841 148..281 100 -> Plus
chrX 13631407..13631830 282..705 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:30 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 149..496 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:12 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 149..496 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:35 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 149..496 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:46 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 149..496 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:45:57 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 149..496 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:27 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..705 1..705 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:12 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..705 1..705 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:35 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..705 1..705 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:47 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..705 1..705 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:45:57 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..705 1..705 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:38 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
X 13739744..13739860 1..117 100 -> Plus
X 13739949..13740112 118..281 100 -> Plus
X 13740678..13741101 282..705 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:38 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
X 13739744..13739860 1..117 100 -> Plus
X 13739949..13740112 118..281 100 -> Plus
X 13740678..13741101 282..705 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:38 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
X 13739744..13739860 1..117 100 -> Plus
X 13739949..13740112 118..281 100 -> Plus
X 13740678..13741101 282..705 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:35 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13633777..13633893 1..117 100 -> Plus
arm_X 13633982..13634145 118..281 100 -> Plus
arm_X 13634711..13635134 282..705 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:21 Download gff for RE42326.complete
Subject Subject Range Query Range Percent Splice Strand
X 13748776..13749199 282..705 100   Plus
X 13747842..13747958 1..117 100 -> Plus
X 13748047..13748210 118..281 100 -> Plus

RE42326.hyp Sequence

Translation from 0 to 495

> RE42326.hyp
TCYTTIPLPHNRGSVVKKATIKSPIARLLLITSRSALKANTPTTTTTTTM
SLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNA
KAYEGPAQGIKVDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIML
TQKLAPLLKTDAKL*

RE42326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-PB 115 CG11151-PB 1..115 50..164 576 100 Plus
CG11151-PA 115 CG11151-PA 1..115 50..164 576 100 Plus

RE42326.pep Sequence

Translation from 148 to 495

> RE42326.pep
MSLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKN
AKAYEGPAQGIKVDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIM
LTQKLAPLLKTDAKL*

RE42326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22601-PA 115 GF22601-PA 1..115 1..115 565 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17809-PA 115 GG17809-PA 1..115 1..115 576 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11852-PA 115 GH11852-PA 1..115 1..115 562 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-PB 115 CG11151-PB 1..115 1..115 576 100 Plus
CG11151-PA 115 CG11151-PA 1..115 1..115 576 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14334-PA 115 GI14334-PA 1..115 1..115 558 94.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19866-PA 115 GL19866-PA 1..115 1..115 570 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10798-PA 115 GA10798-PA 1..115 1..115 570 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17637-PA 115 GM17637-PA 1..115 1..115 576 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24813-PA 96 GD24813-PA 1..95 1..95 450 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19388-PA 115 GJ19388-PA 1..115 1..115 562 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25217-PA 115 GK25217-PA 1..115 1..115 564 96.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17105-PA 115 GE17105-PA 1..115 1..115 576 99.1 Plus