Clone RE42475 Report

Search the DGRC for RE42475

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:424
Well:75
Vector:pFlc-1
Associated Gene/TranscriptCG31997-RA
Protein status:RE42475.pep: gold
Sequenced Size:675

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31997 2001-12-14 Blastp of sequenced clone
CG1651 2002-01-01 Sim4 clustering to Release 2
CG31997 2003-01-01 Sim4 clustering to Release 3
CG31997 2008-04-29 Release 5.5 accounting
CG31997 2008-08-15 Release 5.9 accounting
CG31997 2008-12-18 5.12 accounting

Clone Sequence Records

RE42475.complete Sequence

675 bp (675 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071386

> RE42475.complete
TGGGTGTGAACTTTCGCTTCATTTAGGCTGGTTAGGTGGTTAATTCCATT
TGTCTTCGTTCTTTTGTATTATTTTTACAAAGCGATAATATTTTAATCGT
TTATGATTATTACAATATAACAAAAAGTTAACATCTTTGGAATCTTAAAA
ATGAGTTTTCATTTTGCTGTACTGACCCTTATTTTAACAGCCTTCACAGT
TTCTCTGTGTGCTGAACAAAAAATTACAAAGAGTGACGCAGGTGAAATAC
GAATTTTCAAACGTCTTATTCCTGCCGATGTTCTACGAGATTTTCCGGGA
ATGTGCTTTGCTTCAACTCGATGTGCCACTGTTGAGCCTGGAAAGTCGTG
GGACCTTACTCCATTCTGCGGTCGATCTACTTGTGTTCAAAATGAGGAAA
ATGATGCAAAGCTATTCGAACTCGTAGAAGACTGCGGCCCATTGCCACTG
GCGAATGACAAATGTAAATTGGACACAGAGAAGACTAATAAAACCGCATC
GTTTCCTTATTGCTGCCCCATCTTTACATGTGACCCCGGTGTTAAATTGG
AATACCCCGAGATCGGAAAGGATAATGACAAAAAGAATTCTGAGTGATTC
AAAACAAATATATTATGAAAACGTCTGTCAATACAATAAAAACATTTGTT
GCTTTAGTCAAAAAAAAAAAAAAAA

RE42475.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31997-RA 1146 CG31997-RA 369..1029 4..664 3305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 176399..176684 289..4 1430 100 Minus
chr4 1351717 chr4 175351..175599 659..411 1245 100 Minus
chr4 1351717 chr4 175660..175783 411..288 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 155765..156050 289..4 1430 100 Minus
4 1348131 4 154712..154965 664..411 1270 100 Minus
4 1348131 4 155026..155149 411..288 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 155765..156050 289..4 1430 100 Minus
4 1331231 4 154712..154965 664..411 1270 100 Minus
4 1331231 4 155026..155149 411..288 620 100 Minus
Blast to na_te.dros performed 2019-03-16 02:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 2430..2499 131..59 106 66.7 Minus

RE42475.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:21 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 175351..175599 411..659 100 <- Minus
chr4 175661..175781 290..410 100 <- Minus
chr4 176399..176686 1..289 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:37 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 1..447 151..597 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:33 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 1..447 151..597 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:00 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 1..447 151..597 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:53 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 1..447 151..597 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:57:37 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 1..447 151..597 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:11 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 3..658 4..659 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:32 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 3..658 4..659 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:00 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 8..666 1..659 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:54 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 3..658 4..659 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:57:37 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
CG31997-RA 8..666 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:21 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
4 154717..154965 411..659 100 <- Minus
4 155027..155147 290..410 100 <- Minus
4 155765..156052 1..289 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:21 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
4 154717..154965 411..659 100 <- Minus
4 155027..155147 290..410 100 <- Minus
4 155765..156052 1..289 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:21 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
4 154717..154965 411..659 100 <- Minus
4 155027..155147 290..410 100 <- Minus
4 155765..156052 1..289 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:00 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 175343..175591 411..659 100 <- Minus
arm_4 175653..175773 290..410 100 <- Minus
arm_4 176391..176678 1..289 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:38 Download gff for RE42475.complete
Subject Subject Range Query Range Percent Splice Strand
4 154717..154965 411..659 100 <- Minus
4 155027..155147 290..410 100 <- Minus
4 155765..156052 1..289 99   Minus

RE42475.hyp Sequence

Translation from 150 to 596

> RE42475.hyp
MSFHFAVLTLILTAFTVSLCAEQKITKSDAGEIRIFKRLIPADVLRDFPG
MCFASTRCATVEPGKSWDLTPFCGRSTCVQNEENDAKLFELVEDCGPLPL
ANDKCKLDTEKTNKTASFPYCCPIFTCDPGVKLEYPEIGKDNDKKNSE*

RE42475.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31997-PB 148 CG31997-PB 1..148 1..148 802 100 Plus
CG31997-PA 148 CG31997-PA 1..148 1..148 802 100 Plus

RE42475.pep Sequence

Translation from 150 to 596

> RE42475.pep
MSFHFAVLTLILTAFTVSLCAEQKITKSDAGEIRIFKRLIPADVLRDFPG
MCFASTRCATVEPGKSWDLTPFCGRSTCVQNEENDAKLFELVEDCGPLPL
ANDKCKLDTEKTNKTASFPYCCPIFTCDPGVKLEYPEIGKDNDKKNSE*

RE42475.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19044-PA 150 GF19044-PA 5..148 3..146 591 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16462-PA 151 GG16462-PA 1..151 1..148 709 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23991-PA 157 GH23991-PA 12..154 7..145 539 73.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31997-PB 148 CG31997-PB 1..148 1..148 802 100 Plus
CG31997-PA 148 CG31997-PA 1..148 1..148 802 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14118-PA 143 GI14118-PA 8..133 16..136 514 77.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16601-PA 138 GA16601-PA 8..136 21..146 556 82.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23232-PA 148 GM23232-PA 1..148 1..148 738 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24391-PA 148 GD24391-PA 1..148 1..148 738 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14631-PA 160 GJ14631-PA 43..150 31..136 516 88.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13665-PA 280 GK13665-PA 24..139 21..130 474 76.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14528-PA 151 GE14528-PA 1..151 1..148 709 89.4 Plus