Clone RE42502 Report

Search the DGRC for RE42502

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:425
Well:2
Vector:pFlc-1
Associated Gene/TranscriptNnf1a-RA
Protein status:RE42502.pep: gold
Preliminary Size:585
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13434 2001-12-14 Blastp of sequenced clone
CG13434 2002-01-01 Sim4 clustering to Release 2
CG13434 2003-01-01 Sim4 clustering to Release 3
Nnf1a 2008-04-29 Release 5.5 accounting
Nnf1a 2008-08-15 Release 5.9 accounting
Nnf1a 2008-12-18 5.12 accounting

Clone Sequence Records

RE42502.complete Sequence

667 bp (667 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071387

> RE42502.complete
GTTTGCAATTTGAATTTACTAACAAATTATTTCAATGGAGGATTCGGAAG
CCGCATTTAAACGCCACGAGGGTGTGGGACCAAAGGTGAAACAGGCCTAC
GAGGAAGCCATTAAACAAATCTTTGCCGACTTGAGCTGCGCAGATCTGCA
AGCGTGGGATGCCATTTACCAGGAGCACGAGCAATCCGCTCTGGACACCG
AAAGCATCGTAGATCGCACTCGCAGTCTGATGACCAAGGTTGTGCTCGAA
ATGAACCGATGCTTTTTCGCCAGCAACGATGTGCCAAATAAGTTGCAAAC
TTTGGAAATGCTCAAGGAACATTTCGCTGCCTACGAGGGCAAGAAATGGA
ACGTGAACACTGCAGCACCCGATAAACTAACTCGGCCGCTGCGCATGCGA
TTTTTGGACTTCAGCGTGGAATTCATGGAGCAGCAACTGGCCTCTCAGGC
AAAAGAACTTGAGATTGCTATGGCCAAGAGCAATGCCAATCGCGAGCGAC
TCCAACATGTCCATGACAAGCGCCTGAAATTGACTGTCCAAATGGAGCAG
CAATTGTCGCAGTACGAGAAAGTTAAGACAGAACTTATTAAACTAGGCGA
AGCATTGAACGACTTCTGACAAACTTAAATGCAATAAATAAATAAAATAC
TAAAAAAAAAAAAAAAA

RE42502.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1a-RA 787 Nnf1a-RA 127..778 1..652 3230 99.6 Plus
Nnf1b-RA 787 Nnf1b-RA 413..462 303..352 145 86 Plus
Nnf1b-RA 787 Nnf1b-RA 190..233 80..123 145 88.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16473560..16473775 349..134 1080 100 Minus
chr2R 21145070 chr2R 16472979..16473168 651..462 950 100 Minus
chr2R 21145070 chr2R 16473830..16473964 135..1 660 99.3 Minus
chr2R 21145070 chr2R 16473372..16473487 463..348 565 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20586803..20587018 349..134 1080 100 Minus
2R 25286936 2R 20586221..20586411 652..462 955 100 Minus
2R 25286936 2R 20587073..20587207 135..1 660 99.3 Minus
2R 25286936 2R 20586615..20586730 463..348 565 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20588002..20588217 349..134 1080 100 Minus
2R 25260384 2R 20587420..20587610 652..462 955 100 Minus
2R 25260384 2R 20588272..20588406 135..1 660 99.2 Minus
2R 25260384 2R 20587814..20587929 463..348 565 99.1 Minus
Blast to na_te.dros performed 2019-03-15 16:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5107..5137 619..649 110 83.9 Plus

RE42502.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:18 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16472979..16473166 464..651 100 <- Minus
chr2R 16473372..16473486 349..463 99 <- Minus
chr2R 16473561..16473773 136..348 100 <- Minus
chr2R 16473830..16473964 1..135 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:39 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..585 35..619 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:00 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..585 35..619 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:03:06 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..585 35..619 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:35 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..585 35..619 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:53 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..585 35..619 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:13 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..651 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:00 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 47..697 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:06 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 32..682 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:35 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 1..651 1..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:53 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1a-RA 32..682 1..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:18 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20586615..20586729 349..463 99 <- Minus
2R 20586222..20586409 464..651 100 <- Minus
2R 20586804..20587016 136..348 100 <- Minus
2R 20587073..20587207 1..135 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:18 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20586615..20586729 349..463 99 <- Minus
2R 20586222..20586409 464..651 100 <- Minus
2R 20586804..20587016 136..348 100 <- Minus
2R 20587073..20587207 1..135 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:18 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20586615..20586729 349..463 99 <- Minus
2R 20586222..20586409 464..651 100 <- Minus
2R 20586804..20587016 136..348 100 <- Minus
2R 20587073..20587207 1..135 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:06 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16474120..16474234 349..463 99 <- Minus
arm_2R 16474309..16474521 136..348 100 <- Minus
arm_2R 16474578..16474712 1..135 99   Minus
arm_2R 16473727..16473914 464..651 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:52 Download gff for RE42502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20588003..20588215 136..348 100 <- Minus
2R 20588272..20588406 1..135 99   Minus
2R 20587421..20587608 464..651 100 <- Minus
2R 20587814..20587928 349..463 99 <- Minus

RE42502.pep Sequence

Translation from 34 to 618

> RE42502.pep
MEDSEAAFKRHEGVGPKVKQAYEEAIKQIFADLSCADLQAWDAIYQEHEQ
SALDTESIVDRTRSLMTKVVLEMNRCFFASNDVPNKLQTLEMLKEHFAAY
EGKKWNVNTAAPDKLTRPLRMRFLDFSVEFMEQQLASQAKELEIAMAKSN
ANRERLQHVHDKRLKLTVQMEQQLSQYEKVKTELIKLGEALNDF*

RE42502.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12757-PA 208 GF12757-PA 13..201 5..193 448 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20848-PA 189 GG20848-PA 1..189 1..189 842 84.1 Plus
Dere\GG24745-PA 204 GG24745-PA 6..198 2..194 562 54.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22114-PA 203 GH22114-PA 15..196 5..191 380 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1a-PA 194 CG13434-PA 1..194 1..194 986 100 Plus
Nnf1b-PA 204 CG31658-PA 6..197 2..193 574 57.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19249-PA 164 GI19249-PA 6..155 38..187 350 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17439-PA 217 GL17439-PA 11..207 2..193 487 47.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24826-PA 217 GA24826-PA 11..207 2..193 486 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19776-PA 194 GM19776-PA 1..194 1..194 958 90.7 Plus
Dsec\GM16767-PA 200 GM16767-PA 6..197 2..193 579 56.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25267-PA 194 GD25267-PA 1..194 1..194 969 92.8 Plus
Dsim\GD23046-PA 200 GD23046-PA 6..197 2..193 598 57.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20326-PA 206 GJ20326-PA 15..203 5..193 434 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21831-PA 199 GK21831-PA 7..198 3..194 445 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13787-PA 194 GE13787-PA 1..194 1..194 895 84.5 Plus
Dyak\GE17078-PA 204 GE17078-PA 6..197 2..193 559 53.1 Plus

RE42502.hyp Sequence

Translation from 34 to 618

> RE42502.hyp
MEDSEAAFKRHEGVGPKVKQAYEEAIKQIFADLSCADLQAWDAIYQEHEQ
SALDTESIVDRTRSLMTKVVLEMNRCFFASNDVPNKLQTLEMLKEHFAAY
EGKKWNVNTAAPDKLTRPLRMRFLDFSVEFMEQQLASQAKELEIAMAKSN
ANRERLQHVHDKRLKLTVQMEQQLSQYEKVKTELIKLGEALNDF*

RE42502.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1a-PA 194 CG13434-PA 1..194 1..194 986 100 Plus
Nnf1b-PA 204 CG31658-PA 6..197 2..193 574 57.3 Plus