Clone RE42506 Report

Search the DGRC for RE42506

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:425
Well:6
Vector:pFlc-1
Associated Gene/TranscriptRpL38-RA
Protein status:RE42506.pep: gold
Preliminary Size:213
Sequenced Size:416

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18001 2002-01-01 Sim4 clustering to Release 2
CG40278 2002-01-09 Blastp of sequenced clone
RpL38 2008-04-29 Release 5.5 accounting
RpL38 2008-08-15 Release 5.9 accounting
RpL38 2008-12-18 5.12 accounting

Clone Sequence Records

RE42506.complete Sequence

416 bp (416 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075491

> RE42506.complete
TGTCCTTTCCTTCTATCTACTTGAACAACAACGATCAAAATATAGGTTCT
GTGGATTAATATATCTGAAATTGGATTAATATGCCACGGGAAATTAAAGA
AGTTAAAGATTTTCTTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAA
AAATCAAGAAAAATCCCACTAACACCAAATTTAAGATCCGTTGTTCGAGG
TTCCTTTACACCCTTGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAA
GCAGTCTTTACCGCCTGGACTACAAGTAAAGGAGGTGAAATAAACTACTA
AATGATGGCAGTGCCTCAATATTTCTACTGCTAAGGAATACATTTTGGTT
CGCGATAAATTTGTTTCTGAATAATAAAATGAATTAATTGCACCTAACAC
AAAAAAAAAAAAAAAA

RE42506.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-RA 696 RpL38-RA 44..444 3..403 1990 99.7 Plus
RpL38.b 1308 RpL38.b 44..444 3..403 1990 99.7 Plus
RpL38.a 1431 RpL38.a 44..444 3..403 1990 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 403601..403919 399..81 1595 100 Minus
chr2R 21145070 chr2R 403978..404055 80..3 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4515997..4516319 403..81 1600 99.7 Minus
2R 25286936 2R 4516378..4516455 80..3 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 4517196..4517518 403..81 1600 99.6 Minus
2R 25260384 2R 4517577..4517654 80..3 390 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:55:38 has no hits.

RE42506.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:41 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 403600..403919 81..400 99 <- Minus
chr2R 403978..404056 1..80 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:40 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..213 81..293 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:42 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..213 81..293 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:43 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 1..213 81..293 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:48 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..213 81..293 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:01 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 1..213 81..293 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:20 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..398 3..400 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:42 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..398 3..400 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:43 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 2..400 1..400 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:48 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 1..398 3..400 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:01 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 2..400 1..400 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4516000..4516319 81..400 99 <- Minus
2R 4516378..4516456 1..80 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4516000..4516319 81..400 99 <- Minus
2R 4516378..4516456 1..80 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4516000..4516319 81..400 99 <- Minus
2R 4516378..4516456 1..80 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:43 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 403505..403824 81..400 99 <- Minus
arm_2R 403883..403961 1..80 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:54 Download gff for RE42506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4517199..4517518 81..400 99 <- Minus
2R 4517577..4517655 1..80 98   Minus

RE42506.hyp Sequence

Translation from 80 to 292

> RE42506.hyp
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*

RE42506.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-PA 70 CG18001-PA 1..70 1..70 353 100 Plus
RpL38-PB 70 CG18001-PB 1..70 1..70 353 100 Plus

RE42506.pep Sequence

Translation from 80 to 292

> RE42506.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*

RE42506.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21721-PA 70 GH21721-PA 1..70 1..70 349 98.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-PA 70 CG18001-PA 1..70 1..70 353 100 Plus
RpL38-PB 70 CG18001-PB 1..70 1..70 353 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20680-PA 70 GI20680-PA 1..70 1..70 349 98.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16652-PA 70 GL16652-PA 1..70 1..70 306 88.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21901-PA 70 GJ21901-PA 1..70 1..70 349 98.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21940-PA 70 GK21940-PA 1..70 1..70 352 100 Plus