RE42506.complete Sequence
416 bp (416 high quality bases) assembled on 2002-01-09
GenBank Submission: AY075491
> RE42506.complete
TGTCCTTTCCTTCTATCTACTTGAACAACAACGATCAAAATATAGGTTCT
GTGGATTAATATATCTGAAATTGGATTAATATGCCACGGGAAATTAAAGA
AGTTAAAGATTTTCTTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAA
AAATCAAGAAAAATCCCACTAACACCAAATTTAAGATCCGTTGTTCGAGG
TTCCTTTACACCCTTGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAA
GCAGTCTTTACCGCCTGGACTACAAGTAAAGGAGGTGAAATAAACTACTA
AATGATGGCAGTGCCTCAATATTTCTACTGCTAAGGAATACATTTTGGTT
CGCGATAAATTTGTTTCTGAATAATAAAATGAATTAATTGCACCTAACAC
AAAAAAAAAAAAAAAA
RE42506.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:31:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-RA | 696 | RpL38-RA | 44..444 | 3..403 | 1990 | 99.7 | Plus |
RpL38.b | 1308 | RpL38.b | 44..444 | 3..403 | 1990 | 99.7 | Plus |
RpL38.a | 1431 | RpL38.a | 44..444 | 3..403 | 1990 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:55:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 403601..403919 | 399..81 | 1595 | 100 | Minus |
chr2R | 21145070 | chr2R | 403978..404055 | 80..3 | 390 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:55:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 4515997..4516319 | 403..81 | 1600 | 99.7 | Minus |
2R | 25286936 | 2R | 4516378..4516455 | 80..3 | 390 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 4517196..4517518 | 403..81 | 1600 | 99.6 | Minus |
2R | 25260384 | 2R | 4517577..4517654 | 80..3 | 390 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 19:55:38 has no hits.
RE42506.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:41 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 403600..403919 | 81..400 | 99 | <- | Minus |
chr2R | 403978..404056 | 1..80 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:40 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..213 | 81..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:42 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..213 | 81..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:43 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 1..213 | 81..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:48 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..213 | 81..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:01 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 1..213 | 81..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:20 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..398 | 3..400 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:42 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..398 | 3..400 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:43 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 2..400 | 1..400 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:48 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 1..398 | 3..400 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:01 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 2..400 | 1..400 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4516000..4516319 | 81..400 | 99 | <- | Minus |
2R | 4516378..4516456 | 1..80 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4516000..4516319 | 81..400 | 99 | <- | Minus |
2R | 4516378..4516456 | 1..80 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:41 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4516000..4516319 | 81..400 | 99 | <- | Minus |
2R | 4516378..4516456 | 1..80 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:43 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 403505..403824 | 81..400 | 99 | <- | Minus |
arm_2R | 403883..403961 | 1..80 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:54 Download gff for
RE42506.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4517199..4517518 | 81..400 | 99 | <- | Minus |
2R | 4517577..4517655 | 1..80 | 98 | | Minus |
RE42506.hyp Sequence
Translation from 80 to 292
> RE42506.hyp
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*
RE42506.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-PA | 70 | CG18001-PA | 1..70 | 1..70 | 353 | 100 | Plus |
RpL38-PB | 70 | CG18001-PB | 1..70 | 1..70 | 353 | 100 | Plus |
RE42506.pep Sequence
Translation from 80 to 292
> RE42506.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*
RE42506.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:06:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH21721-PA | 70 | GH21721-PA | 1..70 | 1..70 | 349 | 98.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-PA | 70 | CG18001-PA | 1..70 | 1..70 | 353 | 100 | Plus |
RpL38-PB | 70 | CG18001-PB | 1..70 | 1..70 | 353 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:06:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI20680-PA | 70 | GI20680-PA | 1..70 | 1..70 | 349 | 98.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:06:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL16652-PA | 70 | GL16652-PA | 1..70 | 1..70 | 306 | 88.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:06:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21901-PA | 70 | GJ21901-PA | 1..70 | 1..70 | 349 | 98.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:06:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21940-PA | 70 | GK21940-PA | 1..70 | 1..70 | 352 | 100 | Plus |