Clone RE42582 Report

Search the DGRC for RE42582

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:425
Well:82
Vector:pFlc-1
Associated Gene/TranscriptCoVa-RA
Protein status:RE42582.pep: gold
Preliminary Size:618
Sequenced Size:745

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14724 2002-01-01 Sim4 clustering to Release 2
CG14724 2002-06-10 Blastp of sequenced clone
CG14724 2003-01-01 Sim4 clustering to Release 3
CoVa 2008-04-29 Release 5.5 accounting
CoVa 2008-08-15 Release 5.9 accounting
CoVa 2008-12-18 5.12 accounting

Clone Sequence Records

RE42582.complete Sequence

745 bp (745 high quality bases) assembled on 2002-06-10

GenBank Submission: BT011037

> RE42582.complete
GGCAGTAGCCAGCATCAATGTGGACCGTTGAAAAAGAAACAAGCGACAGT
TATAAACGTGTCCATCCCTGGAAAAGCCAGTGTTGCCAACCATCACTCAG
ATCTGTCATACCCGTGTGAAAAGTAGCAAGAACAAGAAAACATGTTGAGC
ATCACGGCCCGTAACCTGGCAAGCGCCCTCCGCAGCAGCCTCGTCGGCAC
ATCGTCGCGCGTGGCCGCCGTGCGCTGTCTGCACGGAACCGAGGAATCGG
CGGAGGAGTTCGACAAGCGCTACGAGAAGTACTTCAGCCGTGAGGGCATC
GATGGCTGGGAGATCCGCAAGGGCATGAACGATCTGCTGGGCATGGATCT
GGTGCCCAGCCCCAAGATCATCGAGGCCGGTCTGCGTGCCAGCCGTCGCG
TCAACGACATTGCACTGGCCATCAGGTGGCTGGAGGGATGCAAGGACAAG
TGCGGCGACCAAAAGGCCACCCTCTATCCCTACTTGCTGGAGAAGATCAC
CCCCACACTGCAGGAGCTGGGCATCCCAACCATCGAGGAACTGGGCTACG
ACAAGCCCGAATTGGCCCTGAAGTCCGTGTACGATGCCTAAGCGGAGAAC
ACTAGTTTAAAAACACAGAACACAATATACACGTTACAGCGACACTAGCT
ACCTACTATCCAATGTATGGTGCGGATGAACATGTTGTTGGATTGCTAAT
AAATGGAGATTGCAGTAAGGCTACCACACAAAAAAAAAAAAAAAA

RE42582.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CoVa-RA 817 CoVa-RA 27..755 1..729 3645 100 Plus
CoVa.a 778 CoVa.a 190..778 141..729 2945 100 Plus
CoVa-RB 663 CoVa-RB 75..663 141..729 2945 100 Plus
CoVa.a 778 CoVa.a 27..169 1..143 715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7645233..7645821 141..729 2945 100 Plus
chr3R 27901430 chr3R 7645068..7645166 42..140 495 100 Plus
chr3R 27901430 chr3R 7644882..7644924 1..43 215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11819711..11820299 141..729 2945 100 Plus
3R 32079331 3R 11819546..11819644 42..140 495 100 Plus
3R 32079331 3R 11819360..11819402 1..43 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11560542..11561130 141..729 2945 100 Plus
3R 31820162 3R 11560377..11560475 42..140 495 100 Plus
3R 31820162 3R 11560191..11560233 1..43 215 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:33:15 has no hits.

RE42582.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:34:10 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7644882..7644924 1..43 100 -> Plus
chr3R 7645070..7645166 44..140 100 -> Plus
chr3R 7645233..7645821 141..729 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:44 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RB 1..450 142..591 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:15 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RB 1..450 142..591 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:37 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 1..450 142..591 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:42 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RB 1..450 142..591 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:31 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 1..450 142..591 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:54:30 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 2..730 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:15 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 2..730 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:37 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 2..730 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:42 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 2..730 1..729 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:31 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
CoVa-RA 2..730 1..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:10 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11819360..11819402 1..43 100 -> Plus
3R 11819548..11819644 44..140 100 -> Plus
3R 11819711..11820299 141..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:10 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11819360..11819402 1..43 100 -> Plus
3R 11819548..11819644 44..140 100 -> Plus
3R 11819711..11820299 141..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:10 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11819360..11819402 1..43 100 -> Plus
3R 11819548..11819644 44..140 100 -> Plus
3R 11819711..11820299 141..729 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:37 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7645082..7645124 1..43 100 -> Plus
arm_3R 7645270..7645366 44..140 100 -> Plus
arm_3R 7645433..7646021 141..729 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:50:02 Download gff for RE42582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11560542..11561130 141..729 100   Plus
3R 11560191..11560233 1..43 100 -> Plus
3R 11560379..11560475 44..140 100 -> Plus

RE42582.pep Sequence

Translation from 141 to 590

> RE42582.pep
MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSR
EGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGC
KDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA*

RE42582.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23167-PA 149 GF23167-PA 1..148 1..148 693 87.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18466-PA 149 GG18466-PA 1..149 1..149 773 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18193-PA 148 GH18193-PA 1..147 1..148 653 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
COX5A-PC 149 CG14724-PC 1..149 1..149 762 100 Plus
COX5A-PD 149 CG14724-PD 1..149 1..149 762 100 Plus
COX5A-PB 149 CG14724-PB 1..149 1..149 762 100 Plus
COX5A-PA 149 CG14724-PA 1..149 1..149 762 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10146-PA 149 GI10146-PA 1..148 1..148 691 87.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12282-PA 149 GL12282-PA 1..148 1..148 693 88.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13206-PA 149 GA13206-PA 1..148 1..148 693 88.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23980-PA 149 GM23980-PA 1..149 1..149 777 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVa-PA 149 GD18785-PA 1..149 1..149 777 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23365-PA 149 GJ23365-PA 1..148 1..148 703 89.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14516-PA 149 GK14516-PA 1..149 1..149 710 90.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24204-PA 149 GE24204-PA 1..149 1..149 777 100 Plus

RE42582.hyp Sequence

Translation from 141 to 590

> RE42582.hyp
MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSR
EGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGC
KDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA*

RE42582.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CoVa-PC 149 CG14724-PC 1..149 1..149 762 100 Plus
CoVa-PB 149 CG14724-PB 1..149 1..149 762 100 Plus
CoVa-PA 149 CG14724-PA 1..149 1..149 762 100 Plus