BDGP Sequence Production Resources |
Search the DGRC for RE42582
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 425 |
Well: | 82 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CoVa-RA |
Protein status: | RE42582.pep: gold |
Preliminary Size: | 618 |
Sequenced Size: | 745 |
Gene | Date | Evidence |
---|---|---|
CG14724 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14724 | 2002-06-10 | Blastp of sequenced clone |
CG14724 | 2003-01-01 | Sim4 clustering to Release 3 |
CoVa | 2008-04-29 | Release 5.5 accounting |
CoVa | 2008-08-15 | Release 5.9 accounting |
CoVa | 2008-12-18 | 5.12 accounting |
745 bp (745 high quality bases) assembled on 2002-06-10
GenBank Submission: BT011037
> RE42582.complete GGCAGTAGCCAGCATCAATGTGGACCGTTGAAAAAGAAACAAGCGACAGT TATAAACGTGTCCATCCCTGGAAAAGCCAGTGTTGCCAACCATCACTCAG ATCTGTCATACCCGTGTGAAAAGTAGCAAGAACAAGAAAACATGTTGAGC ATCACGGCCCGTAACCTGGCAAGCGCCCTCCGCAGCAGCCTCGTCGGCAC ATCGTCGCGCGTGGCCGCCGTGCGCTGTCTGCACGGAACCGAGGAATCGG CGGAGGAGTTCGACAAGCGCTACGAGAAGTACTTCAGCCGTGAGGGCATC GATGGCTGGGAGATCCGCAAGGGCATGAACGATCTGCTGGGCATGGATCT GGTGCCCAGCCCCAAGATCATCGAGGCCGGTCTGCGTGCCAGCCGTCGCG TCAACGACATTGCACTGGCCATCAGGTGGCTGGAGGGATGCAAGGACAAG TGCGGCGACCAAAAGGCCACCCTCTATCCCTACTTGCTGGAGAAGATCAC CCCCACACTGCAGGAGCTGGGCATCCCAACCATCGAGGAACTGGGCTACG ACAAGCCCGAATTGGCCCTGAAGTCCGTGTACGATGCCTAAGCGGAGAAC ACTAGTTTAAAAACACAGAACACAATATACACGTTACAGCGACACTAGCT ACCTACTATCCAATGTATGGTGCGGATGAACATGTTGTTGGATTGCTAAT AAATGGAGATTGCAGTAAGGCTACCACACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CoVa-RA | 817 | CoVa-RA | 27..755 | 1..729 | 3645 | 100 | Plus |
CoVa.a | 778 | CoVa.a | 190..778 | 141..729 | 2945 | 100 | Plus |
CoVa-RB | 663 | CoVa-RB | 75..663 | 141..729 | 2945 | 100 | Plus |
CoVa.a | 778 | CoVa.a | 27..169 | 1..143 | 715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 7645233..7645821 | 141..729 | 2945 | 100 | Plus |
chr3R | 27901430 | chr3R | 7645068..7645166 | 42..140 | 495 | 100 | Plus |
chr3R | 27901430 | chr3R | 7644882..7644924 | 1..43 | 215 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7644882..7644924 | 1..43 | 100 | -> | Plus |
chr3R | 7645070..7645166 | 44..140 | 100 | -> | Plus |
chr3R | 7645233..7645821 | 141..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RB | 1..450 | 142..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RB | 1..450 | 142..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 1..450 | 142..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RB | 1..450 | 142..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 1..450 | 142..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 2..730 | 1..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 2..730 | 1..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 2..730 | 1..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 2..730 | 1..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVa-RA | 2..730 | 1..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11819360..11819402 | 1..43 | 100 | -> | Plus |
3R | 11819548..11819644 | 44..140 | 100 | -> | Plus |
3R | 11819711..11820299 | 141..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11819360..11819402 | 1..43 | 100 | -> | Plus |
3R | 11819548..11819644 | 44..140 | 100 | -> | Plus |
3R | 11819711..11820299 | 141..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11819360..11819402 | 1..43 | 100 | -> | Plus |
3R | 11819548..11819644 | 44..140 | 100 | -> | Plus |
3R | 11819711..11820299 | 141..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7645082..7645124 | 1..43 | 100 | -> | Plus |
arm_3R | 7645270..7645366 | 44..140 | 100 | -> | Plus |
arm_3R | 7645433..7646021 | 141..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11560542..11561130 | 141..729 | 100 | Plus | |
3R | 11560191..11560233 | 1..43 | 100 | -> | Plus |
3R | 11560379..11560475 | 44..140 | 100 | -> | Plus |
Translation from 141 to 590
> RE42582.pep MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSR EGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGC KDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23167-PA | 149 | GF23167-PA | 1..148 | 1..148 | 693 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18466-PA | 149 | GG18466-PA | 1..149 | 1..149 | 773 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18193-PA | 148 | GH18193-PA | 1..147 | 1..148 | 653 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
COX5A-PC | 149 | CG14724-PC | 1..149 | 1..149 | 762 | 100 | Plus |
COX5A-PD | 149 | CG14724-PD | 1..149 | 1..149 | 762 | 100 | Plus |
COX5A-PB | 149 | CG14724-PB | 1..149 | 1..149 | 762 | 100 | Plus |
COX5A-PA | 149 | CG14724-PA | 1..149 | 1..149 | 762 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10146-PA | 149 | GI10146-PA | 1..148 | 1..148 | 691 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12282-PA | 149 | GL12282-PA | 1..148 | 1..148 | 693 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13206-PA | 149 | GA13206-PA | 1..148 | 1..148 | 693 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23980-PA | 149 | GM23980-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CoVa-PA | 149 | GD18785-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23365-PA | 149 | GJ23365-PA | 1..148 | 1..148 | 703 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14516-PA | 149 | GK14516-PA | 1..149 | 1..149 | 710 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24204-PA | 149 | GE24204-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Translation from 141 to 590
> RE42582.hyp MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSR EGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGC KDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA*