Clone RE42624 Report

Search the DGRC for RE42624

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:426
Well:24
Vector:pFlc-1
Associated Gene/TranscriptDen1-RA
Protein status:RE42624.pep: gold
Preliminary Size:920
Sequenced Size:1260

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8493 2002-01-01 Sim4 clustering to Release 2
CG8493 2002-06-07 Blastp of sequenced clone
CG8493 2003-01-01 Sim4 clustering to Release 3
CG8493 2008-04-29 Release 5.5 accounting
CG8493 2008-08-15 Release 5.9 accounting
CG8493 2008-12-18 5.12 accounting

Clone Sequence Records

RE42624.complete Sequence

1260 bp (1260 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119635

> RE42624.complete
AGCCCAAGCCAGAAAGTAAGATATACAGTACGGCGACTTATTATTTGAGC
GGAAAAGCGAAAAAACTATTCAGAGTGTTGTGTAACTTTTTATATTAGTG
AAAATATCAGTTGGTAAATTCAAGTTATTTGCTCCCAAACAGCCAAATAA
ATGGTAATACGCGAGGAGTGTCCAAAGAACGGACAAAAAGCGAGGTCGCG
ACTTCGAGGAGGAGGAGTAGCCATTTTTCGTGGCAACATACACGCCAGAA
CCAGAATACGAATCGCCGGCGCCCCAGATTCACCAACAATAGCTTCCATA
CCAAAATGGGCAGCAACTCCAAGGCAGACCCCATCTCGCTGACCTTCCAC
GACTCCTGCCTGCGGATGTCCGACGTCCAGTTGCTCCACGGCCCGCACTG
GCTGAACGACCAGATCCTGAGCTTCTACTACGAATACCTGGCCCACATGA
AGTACAAGACCAATGCGGATCTGCACTTCATTGCGCCGGAGATTACGCAG
TGTATGAAGTACATGGGCGACCAGGAGCTGAAGCAGCTTCTCGACCAGAG
CAACACCACTGGCAAGCCCTTTATCTTCTTCGCGCTGAACGACAACGAAA
CCACCGATGCTGGTGGCAGCCACTGGTCACTGTTGGTCTTCTCGCGTCCG
GAGAAGACCTTCTATCACTTCGATTCGTATGGGAACAACAACACGGGCAA
CTCCCTGGAGCTGATGAACAAGATCAAGGACCTGCTTGGCGTCCGAATGG
CCAAATTCCGGCCCATGCGCTGCCTACAGCAGGCGAACGGCTACGACTGT
GGCATCCATGTTATCTGCATGACCGACCACATTGCCGATTACCTAAACAG
ATACGAGGTGATCGACGGACTGCCGTCGCTGCACATCGACACCGTGAAGG
CGAAGCGCACCGAGCTACTGAAACTCATCCTGTCGCTGGGCGGCAAGGGC
TAGAGGCTAGCGAGGATTGCCCTGCCGAACCGCCCACAGCCGAGTAGTTT
TTAAGTGACCAAATTACGAATGTAACTCGTTGCCGAAGAATGAGAGGAGC
ATCGGAATTACATATGTGAATACGATATCCATGATATCGCTAGTTGTAGT
GGGTTTAGTTTTCCTTGCCGAATGAAAATGTTTAAAAAACAAAAGCAAAC
TAAAAGCAATTGAGGCGGTGAGTCGGCATATTTTTAAGGTTGGTCTTTCA
AAATAAAGATTTGTTTAGCCACAAAACGCGTTGGCTTCGAATCCAAAAAA
AAAAAAAAAA

RE42624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RA 1303 Den1-RA 55..1296 1..1242 6195 99.9 Plus
Den1.a 1196 Den1.a 90..1189 143..1242 5500 100 Plus
Den1-RC 1166 Den1-RC 149..1159 232..1242 5055 100 Plus
Den1.a 1196 Den1.a 9..89 1..81 390 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8225791..8226801 232..1242 5040 99.9 Plus
chr2R 21145070 chr2R 8225069..8225301 1..233 1150 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12338532..12339542 232..1242 5055 100 Plus
2R 25286936 2R 12337810..12338042 1..233 1150 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12339731..12340741 232..1242 5055 100 Plus
2R 25260384 2R 12339009..12339241 1..233 1150 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 05:56:08 has no hits.

RE42624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:12 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8225069..8225300 1..232 99 -> Plus
chr2R 8225792..8226803 233..1244 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:45 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RB 1..648 306..953 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:56 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 29..750 232..953 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:29:52 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 29..750 232..953 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:20:11 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RB 1..648 306..953 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:09:43 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 29..750 232..953 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:59:29 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RA 9..1252 1..1244 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:56 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RA 9..1252 1..1244 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:29:52 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RA 14..1257 1..1244 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:20:11 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RA 9..1252 1..1244 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:09:43 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RA 14..1257 1..1244 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:12 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12337810..12338041 1..232 99 -> Plus
2R 12338533..12339544 233..1244 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:12 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12337810..12338041 1..232 99 -> Plus
2R 12338533..12339544 233..1244 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:12 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12337810..12338041 1..232 99 -> Plus
2R 12338533..12339544 233..1244 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:29:52 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8225315..8225546 1..232 99 -> Plus
arm_2R 8226038..8227049 233..1244 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:51 Download gff for RE42624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12339009..12339240 1..232 99 -> Plus
2R 12339732..12340743 233..1244 99   Plus

RE42624.pep Sequence

Translation from 305 to 952

> RE42624.pep
MGSNSKADPISLTFHDSCLRMSDVQLLHGPHWLNDQILSFYYEYLAHMKY
KTNADLHFIAPEITQCMKYMGDQELKQLLDQSNTTGKPFIFFALNDNETT
DAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLELMNKIKDLLGVRMAK
FRPMRCLQQANGYDCGIHVICMTDHIADYLNRYEVIDGLPSLHIDTVKAK
RTELLKLILSLGGKG*

RE42624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19818-PA 215 GF19818-PA 1..215 1..215 1086 91.2 Plus
Dana\GF21854-PA 318 GF21854-PA 98..310 3..213 318 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20277-PA 215 GG20277-PA 1..215 1..215 1132 96.7 Plus
Dere\GG17555-PA 319 GG17555-PA 90..311 2..213 342 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22812-PA 212 GH22812-PA 2..211 5..214 970 82.9 Plus
Dgri\GH22976-PA 212 GH22976-PA 2..211 5..214 767 65.2 Plus
Dgri\GH24159-PA 318 GH24159-PA 97..311 1..211 579 48.4 Plus
Dgri\GH12897-PA 328 GH12897-PA 113..326 3..215 524 48.4 Plus
Dgri\GH16114-PA 285 GH16114-PA 46..244 10..213 349 35.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PA 215 CG8493-PA 1..215 1..215 1156 100 Plus
Den1-PC 249 CG8493-PC 35..249 1..215 1156 100 Plus
CG1503-PB 307 CG1503-PB 88..299 10..213 324 35.8 Plus
CG1503-PA 307 CG1503-PA 88..299 10..213 324 35.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21188-PA 212 GI21188-PA 2..211 5..214 972 81.9 Plus
Dmoj\GI18461-PA 195 GI18461-PA 1..193 21..213 836 77.2 Plus
Dmoj\GI15294-PA 349 GI15294-PA 138..346 5..212 713 59.3 Plus
Dmoj\GI14319-PA 262 GI14319-PA 50..248 10..213 375 36.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10824-PA 215 GL10824-PA 1..214 1..214 1005 84.1 Plus
Dper\GL16580-PA 300 GL16580-PA 74..281 10..213 290 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21116-PA 215 GA21116-PA 1..214 1..214 1005 84.1 Plus
Dpse\GA13447-PA 302 GA13447-PA 76..283 10..213 289 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21362-PA 215 GM21362-PA 1..215 1..215 1159 99.5 Plus
Dsec\GM22639-PA 317 GM22639-PA 97..309 10..213 274 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10859-PA 215 GD10859-PA 1..215 1..215 1159 99.5 Plus
Dsim\GD24436-PA 316 GD24436-PA 97..308 10..213 341 36.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20790-PA 212 GJ20790-PA 2..211 5..214 978 83.3 Plus
Dvir\GJ21548-PA 212 GJ21548-PA 2..210 5..213 892 75.6 Plus
Dvir\GJ16998-PA 377 GJ16998-PA 166..374 5..212 713 60.8 Plus
Dvir\GJ19377-PA 264 GJ19377-PA 36..242 2..213 396 37.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22166-PA 263 GK22166-PA 53..263 5..215 983 82.9 Plus
Dwil\GK10100-PA 308 GK10100-PA 97..306 5..213 735 61.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12437-PA 215 GE12437-PA 1..215 1..215 1139 96.7 Plus
Dyak\GE15316-PA 296 GE15316-PA 75..288 10..213 339 36.4 Plus

RE42624.hyp Sequence

Translation from 305 to 952

> RE42624.hyp
MGSNSKADPISLTFHDSCLRMSDVQLLHGPHWLNDQILSFYYEYLAHMKY
KTNADLHFIAPEITQCMKYMGDQELKQLLDQSNTTGKPFIFFALNDNETT
DAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLELMNKIKDLLGVRMAK
FRPMRCLQQANGYDCGIHVICMTDHIADYLNRYEVIDGLPSLHIDTVKAK
RTELLKLILSLGGKG*

RE42624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PA 215 CG8493-PA 1..215 1..215 1156 100 Plus
Den1-PC 249 CG8493-PC 35..249 1..215 1156 100 Plus
CG1503-PB 307 CG1503-PB 88..299 10..213 324 35.8 Plus
CG1503-PA 307 CG1503-PA 88..299 10..213 324 35.8 Plus