Clone RE42714 Report

Search the DGRC for RE42714

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:427
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG32163-RA
Protein status:RE42714.pep: gold
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32163 2003-01-01 Sim4 clustering to Release 3
CG32163 2004-08-13 Blastp of sequenced clone
CG32163 2008-04-29 Release 5.5 accounting
CG32163 2008-08-15 Release 5.9 accounting
CG32163 2008-12-18 5.12 accounting

Clone Sequence Records

RE42714.complete Sequence

827 bp (827 high quality bases) assembled on 2004-08-13

GenBank Submission: BT015999

> RE42714.complete
CCCCGAATTCCTGAAACTACTCACAAAAATTAAGAAATGCTTTCCAAATT
GCTTCCAATTCTGATTCTGCAAGGTGGCCGAAGAACGTATTCCTTGTGCT
CGAGAGATTACACCATCCCCACAAGTAACCACACCCTAACTGGTCAAATT
TTAAAGGTTCCAAACCTAAATTCGCAGGAAAGATGTTTTGGTACGCACAT
TGTTGTCCGGCATAAGAGAGGTCGGTTCTACACCGACATTGGCGAGCTCC
GGGCTGTATTGGTATACTCCATCAGGGACGGTGTGATGACCATCAACAGC
ACCAACGTCCCGGAGGAACTGGGCGGACATGGCATTGGGAAGCTACTGGC
CAAGTCGGCACTGGACTACGCACTGTTGAATGGGCACTTCATTATTATAA
GGTGTCGGTTTGTCCAGCACTACATCGACAAGTATGAGCCGCAATACGCC
AAGTACATATTAAATTAGGGAACCGAAAACAAAACTTCAAAATTGTCGAC
ACAATCAAACTGAACACAAATAAATCCCCCCACTATGCACATAGACACCA
TACATATAAACGTATATTTGCGTTCAGATTTGTTGAATTCCTTCGGTTTT
TGAAAAATTACATGAAAATAATTTGAATTGGCTTATTTTTAAATTATTTC
AAAATTTCTAAACCGAAAGGTAACAGATTATATTTAATGACGAAATTACG
GTTTCTTATATAAGCTATTTTGTTATGCTTCTAAAAACAAATGTTTTATT
ACCTCTTTAAAATATGTAAACTAGTTTTCACAATATATTTTAAAAAATTG
TTAATTTCCATAAAAAAAAAAAAAAAA

RE42714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32163-RA 807 CG32163-RA 2..807 2..807 4030 100 Plus
CG32163.b 821 CG32163.b 82..821 72..811 3700 100 Plus
CG32163.d 856 CG32163.d 223..856 178..811 3170 100 Plus
CG32163.d 856 CG32163.d 100..223 2..125 620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16577103..16577912 2..811 4050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16587334..16588144 2..812 4055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16580434..16581244 2..812 4055 100 Plus
Blast to na_te.dros performed 2019-03-15 16:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 895..1128 458..694 119 53.7 Plus

RE42714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:19 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16577102..16577912 1..811 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:47 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..432 37..468 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:29 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..432 37..468 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:03:09 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..432 37..468 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:29 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..432 37..468 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:55 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..432 37..468 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:48 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 2..807 2..807 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:29 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 2..811 2..811 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:09 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 177..987 1..811 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:29 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 2..807 2..807 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:55 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
CG32163-RA 1..810 2..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16587333..16588143 1..811 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16587333..16588143 1..811 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16587333..16588143 1..811 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:09 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16580433..16581243 1..811 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:04:32 Download gff for RE42714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16580433..16581243 1..811 99   Plus

RE42714.pep Sequence

Translation from 36 to 467

> RE42714.pep
MLSKLLPILILQGGRRTYSLCSRDYTIPTSNHTLTGQILKVPNLNSQERC
FGTHIVVRHKRGRFYTDIGELRAVLVYSIRDGVMTINSTNVPEELGGHGI
GKLLAKSALDYALLNGHFIIIRCRFVQHYIDKYEPQYAKYILN*

RE42714.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13565-PA 143 GG13565-PA 1..143 1..143 631 81.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32163-PA 143 CG32163-PA 1..143 1..143 748 100 Plus
CG32163-PB 60 CG32163-PB 1..60 84..143 318 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16727-PA 73 GA16727-PA 1..73 71..143 262 68.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25645-PA 144 GM25645-PA 1..144 1..143 676 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14648-PA 143 GD14648-PA 1..143 1..143 709 94.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14364-PA 154 GK14364-PA 39..153 31..142 313 56 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19863-PA 143 GE19863-PA 1..143 1..143 602 78.3 Plus

RE42714.hyp Sequence

Translation from 36 to 467

> RE42714.hyp
MLSKLLPILILQGGRRTYSLCSRDYTIPTSNHTLTGQILKVPNLNSQERC
FGTHIVVRHKRGRFYTDIGELRAVLVYSIRDGVMTINSTNVPEELGGHGI
GKLLAKSALDYALLNGHFIIIRCRFVQHYIDKYEPQYAKYILN*

RE42714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32163-PA 143 CG32163-PA 1..143 1..143 748 100 Plus
CG32163-PB 60 CG32163-PB 1..60 84..143 318 100 Plus