Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
RE42714.complete Sequence
827 bp (827 high quality bases) assembled on 2004-08-13
GenBank Submission: BT015999
> RE42714.complete
CCCCGAATTCCTGAAACTACTCACAAAAATTAAGAAATGCTTTCCAAATT
GCTTCCAATTCTGATTCTGCAAGGTGGCCGAAGAACGTATTCCTTGTGCT
CGAGAGATTACACCATCCCCACAAGTAACCACACCCTAACTGGTCAAATT
TTAAAGGTTCCAAACCTAAATTCGCAGGAAAGATGTTTTGGTACGCACAT
TGTTGTCCGGCATAAGAGAGGTCGGTTCTACACCGACATTGGCGAGCTCC
GGGCTGTATTGGTATACTCCATCAGGGACGGTGTGATGACCATCAACAGC
ACCAACGTCCCGGAGGAACTGGGCGGACATGGCATTGGGAAGCTACTGGC
CAAGTCGGCACTGGACTACGCACTGTTGAATGGGCACTTCATTATTATAA
GGTGTCGGTTTGTCCAGCACTACATCGACAAGTATGAGCCGCAATACGCC
AAGTACATATTAAATTAGGGAACCGAAAACAAAACTTCAAAATTGTCGAC
ACAATCAAACTGAACACAAATAAATCCCCCCACTATGCACATAGACACCA
TACATATAAACGTATATTTGCGTTCAGATTTGTTGAATTCCTTCGGTTTT
TGAAAAATTACATGAAAATAATTTGAATTGGCTTATTTTTAAATTATTTC
AAAATTTCTAAACCGAAAGGTAACAGATTATATTTAATGACGAAATTACG
GTTTCTTATATAAGCTATTTTGTTATGCTTCTAAAAACAAATGTTTTATT
ACCTCTTTAAAATATGTAAACTAGTTTTCACAATATATTTTAAAAAATTG
TTAATTTCCATAAAAAAAAAAAAAAAA
RE42714.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:51:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32163-RA | 807 | CG32163-RA | 2..807 | 2..807 | 4030 | 100 | Plus |
CG32163.b | 821 | CG32163.b | 82..821 | 72..811 | 3700 | 100 | Plus |
CG32163.d | 856 | CG32163.d | 223..856 | 178..811 | 3170 | 100 | Plus |
CG32163.d | 856 | CG32163.d | 100..223 | 2..125 | 620 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:29:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16577103..16577912 | 2..811 | 4050 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:29:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16587334..16588144 | 2..812 | 4055 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16580434..16581244 | 2..812 | 4055 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 16:29:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
McClintock | 6450 | McClintock McCLINTOCK 6450bp | 895..1128 | 458..694 | 119 | 53.7 | Plus |
RE42714.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:19 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16577102..16577912 | 1..811 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:47 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..432 | 37..468 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:29 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..432 | 37..468 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:03:09 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..432 | 37..468 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:29 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..432 | 37..468 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:55 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..432 | 37..468 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:48 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 2..807 | 2..807 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:29 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 2..811 | 2..811 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:09 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 177..987 | 1..811 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:29 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 2..807 | 2..807 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:55 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32163-RA | 1..810 | 2..811 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16587333..16588143 | 1..811 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16587333..16588143 | 1..811 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:19 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16587333..16588143 | 1..811 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:09 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16580433..16581243 | 1..811 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:04:32 Download gff for
RE42714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16580433..16581243 | 1..811 | 99 | | Plus |
RE42714.pep Sequence
Translation from 36 to 467
> RE42714.pep
MLSKLLPILILQGGRRTYSLCSRDYTIPTSNHTLTGQILKVPNLNSQERC
FGTHIVVRHKRGRFYTDIGELRAVLVYSIRDGVMTINSTNVPEELGGHGI
GKLLAKSALDYALLNGHFIIIRCRFVQHYIDKYEPQYAKYILN*
RE42714.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13565-PA | 143 | GG13565-PA | 1..143 | 1..143 | 631 | 81.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32163-PA | 143 | CG32163-PA | 1..143 | 1..143 | 748 | 100 | Plus |
CG32163-PB | 60 | CG32163-PB | 1..60 | 84..143 | 318 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:41:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16727-PA | 73 | GA16727-PA | 1..73 | 71..143 | 262 | 68.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25645-PA | 144 | GM25645-PA | 1..144 | 1..143 | 676 | 91 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14648-PA | 143 | GD14648-PA | 1..143 | 1..143 | 709 | 94.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:41:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14364-PA | 154 | GK14364-PA | 39..153 | 31..142 | 313 | 56 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19863-PA | 143 | GE19863-PA | 1..143 | 1..143 | 602 | 78.3 | Plus |
RE42714.hyp Sequence
Translation from 36 to 467
> RE42714.hyp
MLSKLLPILILQGGRRTYSLCSRDYTIPTSNHTLTGQILKVPNLNSQERC
FGTHIVVRHKRGRFYTDIGELRAVLVYSIRDGVMTINSTNVPEELGGHGI
GKLLAKSALDYALLNGHFIIIRCRFVQHYIDKYEPQYAKYILN*
RE42714.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32163-PA | 143 | CG32163-PA | 1..143 | 1..143 | 748 | 100 | Plus |
CG32163-PB | 60 | CG32163-PB | 1..60 | 84..143 | 318 | 100 | Plus |