RE42781.complete Sequence
559 bp (559 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113470
> RE42781.complete
AGTGAGACATCTCATTATCGCCAGCTTCCAATTCGAATCCTGCATCGCCG
GGAGCCACTCAATCCGTGGGCTTTGATGCAATTTGGCTTCTGTGCAGGCC
ACTCTGCCACTTGGTGTAGCCCGTTTCTGCCCCGTTCTGTTCTGAGAGTT
GCGAGCTGCGAGCTGTGATCTGTGTGGCTCCCCGATCACGCCATGTGTAG
TTTAGTTGCAGTTTCGATTCACATCGGATTGCCTTGCCCAGGCAGCACAT
CAATCATCCATCACGCACCAAAGGCCGGGAGACAACGACCCAAAACGGGC
AGTGCAAACCTGAATGGCAAACGGCCCATGCCACGCATGCGATTTATACG
TGTCCAAGGTTCACTCTGGATCGCAATGGATGCAATTTGGCCACTTCACT
GCACATTTGACCGGATTAAAATTCCTTTCAAATGGCTATATGCTACTAAG
CTCTTTTAAATTGCAGGCATTTTAGTTATTGTTATTTAGCGATCATTTTA
TGTTATCTTTCAATGCAATAAACGATTTAGTTTGTTTAAAAAGGAAAAAA
AAAAAAAAA
RE42781.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:11:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32102-RA | 545 | CG32102-RA | 1..545 | 1..545 | 2725 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 12459685..12460207 | 544..22 | 2615 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:12:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 12469071..12469594 | 545..22 | 2620 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 12462171..12462694 | 545..22 | 2620 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 19:12:51 has no hits.
RE42781.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:35 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 12459685..12460204 | 25..544 | 100 | <- | Minus |
chr3L | 12460374..12460397 | 1..24 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:48 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..267 | 193..459 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:16 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..267 | 193..459 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:52 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..267 | 193..459 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:03:06 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..267 | 193..459 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:43 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:15 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:52 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:33 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:03:06 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32102-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12469072..12469591 | 25..544 | 100 | <- | Minus |
3L | 12469761..12469784 | 1..24 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12469072..12469591 | 25..544 | 100 | <- | Minus |
3L | 12469761..12469784 | 1..24 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12469072..12469591 | 25..544 | 100 | <- | Minus |
3L | 12469761..12469784 | 1..24 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:52 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 12462172..12462691 | 25..544 | 100 | <- | Minus |
arm_3L | 12462861..12462884 | 1..24 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:27 Download gff for
RE42781.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12462172..12462691 | 25..544 | 100 | <- | Minus |
3L | 12462861..12462884 | 1..24 | 100 | | Minus |
RE42781.pep Sequence
Translation from 192 to 458
> RE42781.pep
MCSLVAVSIHIGLPCPGSTSIIHHAPKAGRQRPKTGSANLNGKRPMPRMR
FIRVQGSLWIAMDAIWPLHCTFDRIKIPFKWLYATKLF*
RE42781.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20097-PA | 67 | GF20097-PA | 1..53 | 1..57 | 146 | 61.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:39:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16616-PA | 39 | GG16616-PA | 1..34 | 1..34 | 176 | 100 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32102-PA | 88 | CG32102-PA | 1..88 | 1..88 | 482 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:39:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL20454-PA | 53 | GL20454-PA | 1..35 | 1..35 | 128 | 77.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:39:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23572-PA | 70 | GA23572-PA | 1..35 | 1..35 | 132 | 77.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:39:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19386-PA | 39 | GM19386-PA | 1..34 | 1..34 | 176 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:39:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17924-PA | 39 | GD17924-PA | 1..34 | 1..34 | 176 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:39:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18005-PA | 39 | GE18005-PA | 1..34 | 1..34 | 165 | 94.1 | Plus |
RE42781.hyp Sequence
Translation from 192 to 458
> RE42781.hyp
MCSLVAVSIHIGLPCPGSTSIIHHAPKAGRQRPKTGSANLNGKRPMPRMR
FIRVQGSLWIAMDAIWPLHCTFDRIKIPFKWLYATKLF*
RE42781.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32102-PA | 88 | CG32102-PA | 1..88 | 1..88 | 482 | 100 | Plus |