Clone RE42781 Report

Search the DGRC for RE42781

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:427
Well:81
Vector:pFlc-1
Associated Gene/TranscriptCG32102-RA
Protein status:RE42781.pep: gold
Sequenced Size:559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10488 2002-01-01 Sim4 clustering to Release 2
CG32102 2002-04-26 Blastp of sequenced clone
CG32102 2003-01-01 Sim4 clustering to Release 3
CG32102 2008-04-29 Release 5.5 accounting
CG32102 2008-08-15 Release 5.9 accounting
CG32102 2008-12-18 5.12 accounting

Clone Sequence Records

RE42781.complete Sequence

559 bp (559 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113470

> RE42781.complete
AGTGAGACATCTCATTATCGCCAGCTTCCAATTCGAATCCTGCATCGCCG
GGAGCCACTCAATCCGTGGGCTTTGATGCAATTTGGCTTCTGTGCAGGCC
ACTCTGCCACTTGGTGTAGCCCGTTTCTGCCCCGTTCTGTTCTGAGAGTT
GCGAGCTGCGAGCTGTGATCTGTGTGGCTCCCCGATCACGCCATGTGTAG
TTTAGTTGCAGTTTCGATTCACATCGGATTGCCTTGCCCAGGCAGCACAT
CAATCATCCATCACGCACCAAAGGCCGGGAGACAACGACCCAAAACGGGC
AGTGCAAACCTGAATGGCAAACGGCCCATGCCACGCATGCGATTTATACG
TGTCCAAGGTTCACTCTGGATCGCAATGGATGCAATTTGGCCACTTCACT
GCACATTTGACCGGATTAAAATTCCTTTCAAATGGCTATATGCTACTAAG
CTCTTTTAAATTGCAGGCATTTTAGTTATTGTTATTTAGCGATCATTTTA
TGTTATCTTTCAATGCAATAAACGATTTAGTTTGTTTAAAAAGGAAAAAA
AAAAAAAAA

RE42781.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32102-RA 545 CG32102-RA 1..545 1..545 2725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12459685..12460207 544..22 2615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12469071..12469594 545..22 2620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12462171..12462694 545..22 2620 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:12:51 has no hits.

RE42781.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:35 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12459685..12460204 25..544 100 <- Minus
chr3L 12460374..12460397 1..24 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:48 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..267 193..459 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:16 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..267 193..459 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:52 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..267 193..459 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:03:06 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..267 193..459 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:43 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:15 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:52 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:33 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:03:06 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
CG32102-RA 1..544 1..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12469072..12469591 25..544 100 <- Minus
3L 12469761..12469784 1..24 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12469072..12469591 25..544 100 <- Minus
3L 12469761..12469784 1..24 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:35 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12469072..12469591 25..544 100 <- Minus
3L 12469761..12469784 1..24 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:52 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12462172..12462691 25..544 100 <- Minus
arm_3L 12462861..12462884 1..24 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:27 Download gff for RE42781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12462172..12462691 25..544 100 <- Minus
3L 12462861..12462884 1..24 100   Minus

RE42781.pep Sequence

Translation from 192 to 458

> RE42781.pep
MCSLVAVSIHIGLPCPGSTSIIHHAPKAGRQRPKTGSANLNGKRPMPRMR
FIRVQGSLWIAMDAIWPLHCTFDRIKIPFKWLYATKLF*

RE42781.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20097-PA 67 GF20097-PA 1..53 1..57 146 61.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16616-PA 39 GG16616-PA 1..34 1..34 176 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32102-PA 88 CG32102-PA 1..88 1..88 482 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20454-PA 53 GL20454-PA 1..35 1..35 128 77.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23572-PA 70 GA23572-PA 1..35 1..35 132 77.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19386-PA 39 GM19386-PA 1..34 1..34 176 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17924-PA 39 GD17924-PA 1..34 1..34 176 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18005-PA 39 GE18005-PA 1..34 1..34 165 94.1 Plus

RE42781.hyp Sequence

Translation from 192 to 458

> RE42781.hyp
MCSLVAVSIHIGLPCPGSTSIIHHAPKAGRQRPKTGSANLNGKRPMPRMR
FIRVQGSLWIAMDAIWPLHCTFDRIKIPFKWLYATKLF*

RE42781.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32102-PA 88 CG32102-PA 1..88 1..88 482 100 Plus