Clone RE42883 Report

Search the DGRC for RE42883

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:428
Well:83
Vector:pFlc-1
Associated Gene/TranscriptSod3-RD
Protein status:RE42883.pep: gold
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9027 2004-09-29 Blastp of sequenced clone
CG9027 2008-04-29 Release 5.5 accounting
CG9027 2008-08-15 Release 5.9 accounting
CG9027 2008-12-18 5.12 accounting

Clone Sequence Records

RE42883.complete Sequence

1104 bp (1104 high quality bases) assembled on 2004-09-29

GenBank Submission: BT015997

> RE42883.complete
AGTTCCGTCGCAGGTTTCCAACGGTACAGAGGTGCAATCGCTTAATTCTC
GCAAAAAACAATCAGTACCCAATTATAAAATAGTTGCTAACAAGTTCAAA
ATGATGCAATATCTTGTTGTTAGCCTGGCACTCTGTGCCACAATTTGCTC
TGCTGCGCAGACGCGCAATATGCCCATTCAAGCCATTGCCTATCTGATTG
GACCCGTGCAATCGGATAATACCCAGGTCAAGGGCAACGTGACCTTTACG
CAGAACGACTGTGGCCAGAATGTCCATGTGCGCGTCCAGCTGGAGGGATT
GAAGGAGGGCAAGCACGGCTTCCACATTCACGAGAAGGGAGATCTGACCA
ATGGATGCATCAGCATGGGTGCTCACTATAACCCCGATAAGGTTGATCAC
GGTGGCCCCGATCACGAGGTGCGTCATGTTGGCGATCTGGGCAACCTGGA
GGCCAACTCCACGGGCATTATCGACGTTACATACACGGATCAGGTGATCA
CCTTAACTGGCAAGCTGGGGATCATTGGCAGGGGAGTTGTTGTCCACGAA
TTGGAGGATGATCTCGGTCTGGGCAACCACACGGATTCCAAGAAGACCGG
CAATGCAGGCGGCCGCATTGCCTGTGGTGTTATTGGCATCAACTCGGATG
TGGACGAGTGGCCATGTCGCGATGGTGGCGCCGGCGCCCTGCGCTACTCC
TTCTCCATCCTGACCGTCATCGTGGCCCTCATCATGGCCCGCAGCCTTGA
CTAATCCGAAACATGCACCCGGATCGGATCGAATGCACGCATGTGGCATG
GGATTGTTGGCCATCGTAGTGATCTGCATACCTACTTACACACTAACCAC
ACAACCATGAGTCGCACACCACTACCAACAGTAATTATAATACTCCAGCA
TTATCCACCCAAATAGAGAAATCAAAGGAACTAACTAAGCTACTTGTAAA
GTGTTTGAATTGATCGATAATAAAGTTTGTTATTTGTATTTCGGGTGCTT
GCAATTTGTACGTGCTTAGATAGTAACAAAAGTTGCTGAAAATGAACGAC
AGATAAGGGTTAGCTCTAATTTTATAAAAAAGATTAGACAAAAAAAAAAA
AAAA

RE42883.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9027-RD 1384 CG9027-RD 293..1384 1..1092 5460 100 Plus
CG9027.a 1641 CG9027.a 841..1390 93..642 2750 100 Plus
CG9027-RC 2635 CG9027-RC 1790..2339 93..642 2750 100 Plus
CG9027.a 1641 CG9027.a 1..94 1..94 470 100 Plus
CG9027-RC 2635 CG9027-RC 1..94 1..94 470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7267804..7268250 1089..643 2190 99.3 Minus
chr2R 21145070 chr2R 7269391..7269625 397..163 1160 99.6 Minus
chr2R 21145070 chr2R 7269112..7269342 620..390 1110 98.7 Minus
chr2R 21145070 chr2R 7271457..7271550 94..1 470 100 Minus
chr2R 21145070 chr2R 7269691..7269761 163..93 340 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11380344..11380793 1092..643 2250 100 Minus
2R 25286936 2R 11381949..11382183 397..163 1160 99.6 Minus
2R 25286936 2R 11381663..11381893 620..390 1155 100 Minus
2R 25286936 2R 11384015..11384108 94..1 470 100 Minus
2R 25286936 2R 11382249..11382319 163..93 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11381543..11381992 1092..643 2250 100 Minus
2R 25260384 2R 11383148..11383382 397..163 1160 99.5 Minus
2R 25260384 2R 11382862..11383092 620..390 1155 100 Minus
2R 25260384 2R 11385214..11385307 94..1 470 100 Minus
2R 25260384 2R 11383448..11383518 163..93 355 100 Minus
Blast to na_te.dros performed 2019-03-16 02:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 2346..2418 651..721 126 65.8 Plus

RE42883.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:30 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7269691..7269759 95..163 98 <- Minus
chr2R 7271457..7271550 1..94 100   Minus
chr2R 7269397..7269624 164..391 100 <- Minus
chr2R 7267804..7268250 643..1089 99 <- Minus
chr2R 7269022..7269043 621..642 100 <- Minus
chr2R 7269112..7269340 392..620 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:51 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..654 101..754 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:03 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..654 101..754 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:13 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RD 1..654 101..754 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:15:52 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..654 101..754 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:57:58 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RD 1..654 101..754 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:04 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..1089 1..1089 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:03 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..1089 1..1089 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:13 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RD 7..1095 1..1089 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:15:53 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RD 1..1089 1..1089 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:57:58 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RD 7..1095 1..1089 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:30 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381663..11381891 392..620 100 <- Minus
2R 11380347..11380793 643..1089 100 <- Minus
2R 11381573..11381594 621..642 100 <- Minus
2R 11381955..11382182 164..391 100 <- Minus
2R 11382249..11382317 95..163 100 <- Minus
2R 11384015..11384108 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:30 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381663..11381891 392..620 100 <- Minus
2R 11380347..11380793 643..1089 100 <- Minus
2R 11381573..11381594 621..642 100 <- Minus
2R 11381955..11382182 164..391 100 <- Minus
2R 11382249..11382317 95..163 100 <- Minus
2R 11384015..11384108 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:30 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381663..11381891 392..620 100 <- Minus
2R 11380347..11380793 643..1089 100 <- Minus
2R 11381573..11381594 621..642 100 <- Minus
2R 11381955..11382182 164..391 100 <- Minus
2R 11382249..11382317 95..163 100 <- Minus
2R 11384015..11384108 1..94 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:13 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7271520..7271613 1..94 100   Minus
arm_2R 7269168..7269396 392..620 100 <- Minus
arm_2R 7267852..7268298 643..1089 100 <- Minus
arm_2R 7269078..7269099 621..642 100 <- Minus
arm_2R 7269460..7269687 164..391 100 <- Minus
arm_2R 7269754..7269822 95..163 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:50 Download gff for RE42883.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11383154..11383381 164..391 100 <- Minus
2R 11383448..11383516 95..163 100 <- Minus
2R 11381546..11381992 643..1089 100 <- Minus
2R 11382772..11382793 621..642 100 <- Minus
2R 11382862..11383090 392..620 100 <- Minus
2R 11385214..11385307 1..94 100   Minus

RE42883.hyp Sequence

Translation from 0 to 753

> RE42883.hyp
VPSQVSNGTEVQSLNSRKKQSVPNYKIVANKFKMMQYLVVSLALCATICS
AAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGL
KEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLE
ANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTG
NAGGRIACGVIGINSDVDEWPCRDGGAGALRYSFSILTVIVALIMARSLD
*

RE42883.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Sod3-PD 217 CG9027-PD 1..217 34..250 1145 100 Plus
Sod3-PE 243 CG9027-PE 1..181 34..214 961 100 Plus
Sod3-PA 181 CG9027-PA 1..180 34..213 955 100 Plus
Sod3-PB 181 CG9027-PB 1..180 34..213 955 100 Plus
Sod-PA 153 CG11793-PA 10..150 73..213 374 55.3 Plus

RE42883.pep Sequence

Translation from 1 to 753

> RE42883.pep
VPSQVSNGTEVQSLNSRKKQSVPNYKIVANKFKMMQYLVVSLALCATICS
AAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGL
KEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLE
ANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTG
NAGGRIACGVIGINSDVDEWPCRDGGAGALRYSFSILTVIVALIMARSLD
*

RE42883.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12396-PA 210 GF12396-PA 1..210 35..250 913 80.6 Plus
Dana\GF24570-PA 153 GF24570-PA 1..150 57..213 350 51 Plus
Dana\GF18703-PA 124 GF18703-PA 9..121 101..213 287 54.9 Plus
Dana\GF11145-PA 263 GF11145-PA 86..233 72..219 269 42.4 Plus
Dana\GF16781-PA 267 GF16781-PA 94..247 60..215 155 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22650-PA 181 GG22650-PA 1..180 34..213 907 95 Plus
Dere\Sod-PA 153 GG13936-PA 10..150 73..213 350 54.6 Plus
Dere\GG25230-PA 264 GG25230-PA 86..234 72..219 248 42.1 Plus
Dere\GG22651-PA 96 GG22651-PA 60..96 214..250 180 83.8 Plus
Dere\GG11434-PA 270 GG11434-PA 94..247 60..215 163 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20507-PA 181 GH20507-PA 1..180 34..213 783 78.9 Plus
Dgri\GH11755-PA 181 GH11755-PA 1..180 34..213 760 77.2 Plus
Dgri\GH14640-PA 153 GH14640-PA 10..150 73..213 355 54.6 Plus
Dgri\GH19972-PA 285 GH19972-PA 108..247 72..211 273 46.9 Plus
Dgri\GH22309-PA 256 GH22309-PA 90..248 60..221 182 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Sod3-PD 217 CG9027-PD 1..217 34..250 1145 100 Plus
Sod3-PE 243 CG9027-PE 1..181 34..214 961 100 Plus
Sod3-PF 181 CG9027-PF 1..180 34..213 955 100 Plus
Sod3-PA 181 CG9027-PA 1..180 34..213 955 100 Plus
Sod3-PB 181 CG9027-PB 1..180 34..213 955 100 Plus
Sod1-PA 153 CG11793-PA 10..150 73..213 374 55.3 Plus
Sod1-PD 167 CG11793-PD 30..164 79..213 361 55.6 Plus
Ccs-PC 258 CG17753-PC 80..228 72..219 277 42.1 Plus
Ccs-PB 264 CG17753-PB 86..234 72..219 277 42.1 Plus
CG5948-PB 269 CG5948-PB 93..246 60..215 172 29.2 Plus
CG5948-PA 270 CG5948-PA 94..247 60..215 172 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21051-PA 181 GI21051-PA 1..180 34..213 784 78.9 Plus
Dmoj\GI11624-PA 153 GI11624-PA 10..150 73..213 349 54.6 Plus
Dmoj\GI20259-PA 236 GI20259-PA 86..219 72..205 250 44.5 Plus
Dmoj\GI22979-PA 271 GI22979-PA 105..255 70..221 173 27.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10397-PA 277 GL10397-PA 1..181 34..214 830 82.9 Plus
Dper\Sod-PA 152 GL22843-PA 9..149 73..213 351 53.9 Plus
Dper\GL20081-PA 263 GL20081-PA 86..233 72..219 260 40.4 Plus
Dper\GL21798-PA 267 GL21798-PA 95..246 60..213 165 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30465-PA 258 GA30465-PA 1..180 34..213 830 82.8 Plus
Dpse\GA30465-PB 181 GA30465-PB 1..180 34..213 826 82.8 Plus
Dpse\Sod-PA 152 GA11202-PA 9..149 73..213 351 53.9 Plus
Dpse\GA14646-PA 263 GA14646-PA 86..233 72..219 260 40.4 Plus
Dpse\GA19252-PA 266 GA19252-PA 94..245 60..213 165 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20432-PA 181 GM20432-PA 1..180 34..213 934 97.2 Plus
Dsec\Sod-PA 153 GM24771-PA 10..150 73..213 354 55.3 Plus
Dsec\GM20549-PA 264 GM20549-PA 86..234 72..219 248 42.1 Plus
Dsec\GM20433-PA 96 GM20433-PA 60..96 214..250 192 94.6 Plus
Dsec\GM10274-PA 270 GM10274-PA 94..247 60..215 162 30.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25903-PA 181 GD25903-PA 1..180 34..213 939 98.3 Plus
Dsim\Sod-PA 153 GD12822-PA 10..150 73..213 354 55.3 Plus
Dsim\GD26004-PA 264 GD26004-PA 86..234 72..219 250 42.8 Plus
Dsim\GD25904-PA 96 GD25904-PA 60..96 214..250 192 94.6 Plus
Dsim\GD21244-PA 270 GD21244-PA 94..247 60..215 165 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21975-PA 181 GJ21975-PA 1..180 34..213 761 76.7 Plus
Dvir\Sod-PA 153 GJ11304-PA 10..150 73..213 354 55.3 Plus
Dvir\GJ20212-PA 263 GJ20212-PA 86..225 72..211 265 44.8 Plus
Dvir\GJ24673-PA 268 GJ24673-PA 94..246 60..215 172 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21886-PA 181 GK21886-PA 1..180 34..213 792 80.6 Plus
Dwil\GK13564-PA 157 GK13564-PA 1..154 34..190 619 74.5 Plus
Dwil\Sod-PA 153 GK20556-PA 10..150 73..213 376 56.7 Plus
Dwil\GK23033-PA 252 GK23033-PA 87..214 72..211 174 35.5 Plus
Dwil\GK12866-PA 257 GK12866-PA 98..235 74..211 156 28.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13524-PA 181 GE13524-PA 1..180 34..213 917 95.6 Plus
Dyak\Sod-PA 153 GE20235-PA 10..150 73..213 345 53.9 Plus
Dyak\GE21764-PA 264 GE21764-PA 86..234 72..219 258 42.8 Plus
Dyak\GE13525-PA 100 GE13525-PA 64..100 214..250 195 97.3 Plus
Dyak\GE23628-PA 270 GE23628-PA 94..247 60..215 159 29.8 Plus