BDGP Sequence Production Resources |
Search the DGRC for RE42959
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 429 |
Well: | 59 |
Vector: | pFlc-1 |
Associated Gene/Transcript | l(2)37Ce-RA |
Protein status: | RE42959.pep: gold |
Preliminary Size: | 558 |
Sequenced Size: | 718 |
Gene | Date | Evidence |
---|---|---|
CG17347 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17347 | 2003-01-01 | Sim4 clustering to Release 3 |
l(2)37Ce | 2008-04-29 | Release 5.5 accounting |
l(2)37Ce | 2008-08-15 | Release 5.9 accounting |
l(2)37Ce | 2008-12-18 | 5.12 accounting |
718 bp (718 high quality bases) assembled on 2005-08-09
GenBank Submission: BT023827
> RE42959.complete ATTTATTATCGATAAATATAAATTCCTTCTCACCTTCGTGAGAAAACGTA AACAATTTAAGAAAACAGAAAATGCCCTCGGAAAACAGAATCAAAATCCT ACCCAAGGCGGTGGTCTGCGAGGAGAGCAGCCTGCGCGGTGACATCACCT TCTCGTCGGGCTGTGTGGTTCATCCGAGTGCCACCGTTATCGCCGACGCA GGTCCCATAATAATTGGGGAGAATTGCATCATAGAGGAATATGCCACCGT AGCTCACCGCTTGGAGCCGGGCGCCGTTTGGGATGTCAACAATATCCTGA GCATTGGCACTCACAATGTCTTTGAAGTCGGCTGCCAAGTGGAAGCGGCC AAGATTGGCGATAAGAACGTCTTCGAGAGCAAGTGCTATGTGGGCCCCGG TGTCACTGTTTCCAGCGGTTGTGTGGTGGGAGCTGGAATAAAGATCCATG GTAGTCAACGCCTGCCCGAAAACACGATTGTTTATGGAGAGCAGGGCCTG CAGCGCGAGGCCATCGACAAGCAGGGATCGCAGACCCTGCAGATCGACTT CCTGCGCAAGGTCCTGCCAAACTATCATCATCTACGCAAGCCCAACTACG ATCCCAAGAAGGCGCGCAGCGTGGTTTAGTTTTAAGTATTCTTTATACAT ATATATCTAATTTTCCACTTTCATTGCATTAAACTCGGCCATCTCCTTTT CGAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19130909..19130996 | 1..88 | 100 | -> | Plus |
chr2L | 19131064..19131677 | 89..702 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..558 | 72..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..558 | 72..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..558 | 72..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..558 | 72..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..558 | 72..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..629 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..702 | 1..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 7..708 | 1..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 1..629 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)37Ce-RA | 7..708 | 1..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19132329..19132416 | 1..88 | 100 | -> | Plus |
2L | 19132484..19133097 | 89..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19132329..19132416 | 1..88 | 100 | -> | Plus |
2L | 19132484..19133097 | 89..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19132329..19132416 | 1..88 | 100 | -> | Plus |
2L | 19132484..19133097 | 89..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19132329..19132416 | 1..88 | 100 | -> | Plus |
arm_2L | 19132484..19133097 | 89..702 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19132484..19133097 | 89..702 | 100 | Plus | |
2L | 19132329..19132416 | 1..88 | 100 | -> | Plus |
Translation from 71 to 628
> RE42959.pep MPSENRIKILPKAVVCEESSLRGDITFSSGCVVHPSATVIADAGPIIIGE NCIIEEYATVAHRLEPGAVWDVNNILSIGTHNVFEVGCQVEAAKIGDKNV FESKCYVGPGVTVSSGCVVGAGIKIHGSQRLPENTIVYGEQGLQREAIDK QGSQTLQIDFLRKVLPNYHHLRKPNYDPKKARSVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14705-PA | 186 | GF14705-PA | 1..186 | 1..185 | 838 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21162-PA | 185 | GG21162-PA | 1..185 | 1..185 | 934 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13438-PA | 185 | GH13438-PA | 1..185 | 1..185 | 843 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
DCTN6-p27-PA | 185 | CG17347-PA | 1..185 | 1..185 | 967 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13989-PA | 185 | GI13989-PA | 1..185 | 1..185 | 840 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21190-PA | 185 | GL21190-PA | 1..185 | 1..185 | 863 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14472-PA | 185 | GA14472-PA | 1..185 | 1..185 | 863 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17329-PA | 185 | GM17329-PA | 1..185 | 1..185 | 955 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24187-PA | 185 | GD24187-PA | 1..185 | 1..185 | 950 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18245-PA | 185 | GJ18245-PA | 1..185 | 1..185 | 865 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23850-PA | 185 | GK23850-PA | 1..185 | 1..185 | 838 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13235-PA | 185 | GE13235-PA | 1..185 | 1..185 | 934 | 94.6 | Plus |
Translation from 71 to 628
> RE42959.hyp MPSENRIKILPKAVVCEESSLRGDITFSSGCVVHPSATVIADAGPIIIGE NCIIEEYATVAHRLEPGAVWDVNNILSIGTHNVFEVGCQVEAAKIGDKNV FESKCYVGPGVTVSSGCVVGAGIKIHGSQRLPENTIVYGEQGLQREAIDK QGSQTLQIDFLRKVLPNYHHLRKPNYDPKKARSVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(2)37Ce-PA | 185 | CG17347-PA | 1..185 | 1..185 | 967 | 100 | Plus |