Clone RE42959 Report

Search the DGRC for RE42959

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:429
Well:59
Vector:pFlc-1
Associated Gene/Transcriptl(2)37Ce-RA
Protein status:RE42959.pep: gold
Preliminary Size:558
Sequenced Size:718

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17347 2002-01-01 Sim4 clustering to Release 2
CG17347 2003-01-01 Sim4 clustering to Release 3
l(2)37Ce 2008-04-29 Release 5.5 accounting
l(2)37Ce 2008-08-15 Release 5.9 accounting
l(2)37Ce 2008-12-18 5.12 accounting

Clone Sequence Records

RE42959.complete Sequence

718 bp (718 high quality bases) assembled on 2005-08-09

GenBank Submission: BT023827

> RE42959.complete
ATTTATTATCGATAAATATAAATTCCTTCTCACCTTCGTGAGAAAACGTA
AACAATTTAAGAAAACAGAAAATGCCCTCGGAAAACAGAATCAAAATCCT
ACCCAAGGCGGTGGTCTGCGAGGAGAGCAGCCTGCGCGGTGACATCACCT
TCTCGTCGGGCTGTGTGGTTCATCCGAGTGCCACCGTTATCGCCGACGCA
GGTCCCATAATAATTGGGGAGAATTGCATCATAGAGGAATATGCCACCGT
AGCTCACCGCTTGGAGCCGGGCGCCGTTTGGGATGTCAACAATATCCTGA
GCATTGGCACTCACAATGTCTTTGAAGTCGGCTGCCAAGTGGAAGCGGCC
AAGATTGGCGATAAGAACGTCTTCGAGAGCAAGTGCTATGTGGGCCCCGG
TGTCACTGTTTCCAGCGGTTGTGTGGTGGGAGCTGGAATAAAGATCCATG
GTAGTCAACGCCTGCCCGAAAACACGATTGTTTATGGAGAGCAGGGCCTG
CAGCGCGAGGCCATCGACAAGCAGGGATCGCAGACCCTGCAGATCGACTT
CCTGCGCAAGGTCCTGCCAAACTATCATCATCTACGCAAGCCCAACTACG
ATCCCAAGAAGGCGCGCAGCGTGGTTTAGTTTTAAGTATTCTTTATACAT
ATATATCTAATTTTCCACTTTCATTGCATTAAACTCGGCCATCTCCTTTT
CGAAAAAAAAAAAAAAAA

RE42959.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Ce-RA 740 l(2)37Ce-RA 23..726 1..704 3520 100 Plus
l(2)37Cg.a 398 l(2)37Cg.a 322..398 704..628 385 100 Minus
l(2)37Cg-RA 461 l(2)37Cg-RA 385..461 704..628 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19131059..19131677 84..702 3080 99.8 Plus
chr2L 23010047 chr2L 19130909..19130996 1..88 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19132479..19133099 84..704 3105 100 Plus
2L 23513712 2L 19132329..19132416 1..88 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19132479..19133099 84..704 3105 100 Plus
2L 23513712 2L 19132329..19132416 1..88 440 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:03:39 has no hits.

RE42959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:04:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19130909..19130996 1..88 100 -> Plus
chr2L 19131064..19131677 89..702 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:16:54 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..558 72..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:58 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..558 72..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..558 72..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:34:41 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..558 72..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:46:09 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..558 72..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:29:19 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..629 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:58 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 7..708 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:34:41 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 1..629 1..629 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:46:09 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Ce-RA 7..708 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19132329..19132416 1..88 100 -> Plus
2L 19132484..19133097 89..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19132329..19132416 1..88 100 -> Plus
2L 19132484..19133097 89..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19132329..19132416 1..88 100 -> Plus
2L 19132484..19133097 89..702 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:46 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19132329..19132416 1..88 100 -> Plus
arm_2L 19132484..19133097 89..702 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:13:15 Download gff for RE42959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19132484..19133097 89..702 100   Plus
2L 19132329..19132416 1..88 100 -> Plus

RE42959.pep Sequence

Translation from 71 to 628

> RE42959.pep
MPSENRIKILPKAVVCEESSLRGDITFSSGCVVHPSATVIADAGPIIIGE
NCIIEEYATVAHRLEPGAVWDVNNILSIGTHNVFEVGCQVEAAKIGDKNV
FESKCYVGPGVTVSSGCVVGAGIKIHGSQRLPENTIVYGEQGLQREAIDK
QGSQTLQIDFLRKVLPNYHHLRKPNYDPKKARSVV*

RE42959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14705-PA 186 GF14705-PA 1..186 1..185 838 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21162-PA 185 GG21162-PA 1..185 1..185 934 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13438-PA 185 GH13438-PA 1..185 1..185 843 83.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
DCTN6-p27-PA 185 CG17347-PA 1..185 1..185 967 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13989-PA 185 GI13989-PA 1..185 1..185 840 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21190-PA 185 GL21190-PA 1..185 1..185 863 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14472-PA 185 GA14472-PA 1..185 1..185 863 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17329-PA 185 GM17329-PA 1..185 1..185 955 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24187-PA 185 GD24187-PA 1..185 1..185 950 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18245-PA 185 GJ18245-PA 1..185 1..185 865 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23850-PA 185 GK23850-PA 1..185 1..185 838 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13235-PA 185 GE13235-PA 1..185 1..185 934 94.6 Plus

RE42959.hyp Sequence

Translation from 71 to 628

> RE42959.hyp
MPSENRIKILPKAVVCEESSLRGDITFSSGCVVHPSATVIADAGPIIIGE
NCIIEEYATVAHRLEPGAVWDVNNILSIGTHNVFEVGCQVEAAKIGDKNV
FESKCYVGPGVTVSSGCVVGAGIKIHGSQRLPENTIVYGEQGLQREAIDK
QGSQTLQIDFLRKVLPNYHHLRKPNYDPKKARSVV*

RE42959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Ce-PA 185 CG17347-PA 1..185 1..185 967 100 Plus