Clone RE43278 Report

Search the DGRC for RE43278

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:432
Well:78
Vector:pFlc-1
Associated Gene/TranscriptmRpL17-RA
Protein status:RE43278.pep: gold
Preliminary Size:504
Sequenced Size:761

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13880 2002-01-01 Sim4 clustering to Release 2
CG13880 2002-06-07 Blastp of sequenced clone
CG13880 2003-01-01 Sim4 clustering to Release 3
mRpL17 2008-04-29 Release 5.5 accounting
mRpL17 2008-08-15 Release 5.9 accounting
mRpL17 2008-12-18 5.12 accounting

Clone Sequence Records

RE43278.complete Sequence

761 bp (761 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119639

> RE43278.complete
AAATGGTCGCCAGCTGTTCGGCGAATGTTACGTGATTTCCTATTTGTAAC
ATTGCTAAAAATCGAGTAAAATGAATCAAGCCGATGTAACAAAGCTCATG
TCACAGCTGCGTATAGCGGTCAGGCCCAACAAGCGCCATCTGAAGAATGT
CGATGGCCCGGAAGGTCGGCTGCTGAAGCTGCGTAAGACCGTCACTGCGT
TGGTGAAGCACGAGCGTATTGAACTGTTCTACAACCGTGCCGATGAAGCT
CGTGGCTACGCCGAACTGCTCATTTCCAATGCCATACGCCATGGGGACCG
ACACCAAGCCACCATGGAACTGGCGGACTATTGGCTGCTGGAAAAGCAAC
TGGTTCATAAGCTCTTCAAGGTGCTGGTACCGCGCTATGAGACTTACAAT
GTGTCCTACACTCGCATGTACAAAGCCCCTCGGGAGTATCCTGGCATTTA
CTACAGGCGGTCTGTGCTGGAGCTTCGGGGCAATCCCTACCCTTCGCTGG
CGGCGGATCATTCTCAGAACCGGAATCTGCTGCACAATGTGCTTCTGGAC
GAGGCGAGAAAGGAGTTTAGGCGTCAAAAACTGTCGGAGTTAGTTCACTA
ATAGCTCTTTTCACTAACCGCCTGTTTATTTAGTAGATTAGCAAGCAGTT
TGTCGCTTAGAATTCACGTAAGACTTAAAAGCATCTTTATTATAAATGTA
TGTATACACAAAACGAATTGTTTGAATTAAGAGTTGAACTTATACAAAAA
AAAAAAAAAAA

RE43278.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL17-RA 1014 mRpL17-RA 128..875 1..748 3740 100 Plus
mRpL17.a 1143 mRpL17.a 128..824 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 265065..265542 268..745 2390 100 Plus
chr3L 24539361 chr3L 264736..265003 1..268 1340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 265111..265591 268..748 2405 100 Plus
3L 28110227 3L 264782..265049 1..268 1340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 265111..265591 268..748 2405 100 Plus
3L 28103327 3L 264782..265049 1..268 1340 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:56:43 has no hits.

RE43278.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:28 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 264736..265003 1..268 100 -> Plus
chr3L 265066..265542 269..745 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:09 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..531 71..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:30:02 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..531 71..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:30:06 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..531 71..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:20:18 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..531 71..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:04 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..531 71..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:59:37 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..745 1..745 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:30:02 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..745 1..745 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:06 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 4..748 1..745 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:20:19 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 1..745 1..745 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:04 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL17-RA 4..748 1..745 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:28 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 264782..265049 1..268 100 -> Plus
3L 265112..265588 269..745 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:28 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 264782..265049 1..268 100 -> Plus
3L 265112..265588 269..745 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:28 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 264782..265049 1..268 100 -> Plus
3L 265112..265588 269..745 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:06 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 264782..265049 1..268 100 -> Plus
arm_3L 265112..265588 269..745 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:58 Download gff for RE43278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 264782..265049 1..268 100 -> Plus
3L 265112..265588 269..745 100   Plus

RE43278.pep Sequence

Translation from 70 to 600

> RE43278.pep
MNQADVTKLMSQLRIAVRPNKRHLKNVDGPEGRLLKLRKTVTALVKHERI
ELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQLVHKLFK
VLVPRYETYNVSYTRMYKAPREYPGIYYRRSVLELRGNPYPSLAADHSQN
RNLLHNVLLDEARKEFRRQKLSELVH*

RE43278.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25043-PA 176 GF25043-PA 1..176 1..176 802 85.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14709-PA 177 GG14709-PA 1..176 1..176 890 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15737-PA 197 GH15737-PA 1..176 1..176 795 82.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL17-PB 176 CG13880-PB 1..176 1..176 910 100 Plus
mRpL17-PA 176 CG13880-PA 1..176 1..176 910 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12794-PA 215 GI12794-PA 1..176 1..176 827 88.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16123-PA 176 GL16123-PA 1..175 1..175 827 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28391-PA 176 GA28391-PA 1..175 1..175 827 89.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14324-PA 176 GM14324-PA 1..176 1..176 904 98.3 Plus
Dsec\GM23092-PA 71 GM23092-PA 1..67 1..67 336 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11005-PA 176 GD11005-PA 1..176 1..176 904 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16093-PA 324 GJ16093-PA 1..176 1..176 802 84.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16542-PA 201 GK16542-PA 1..176 1..176 815 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21072-PA 177 GE21072-PA 1..176 1..176 884 94.9 Plus

RE43278.hyp Sequence

Translation from 70 to 600

> RE43278.hyp
MNQADVTKLMSQLRIAVRPNKRHLKNVDGPEGRLLKLRKTVTALVKHERI
ELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQLVHKLFK
VLVPRYETYNVSYTRMYKAPREYPGIYYRRSVLELRGNPYPSLAADHSQN
RNLLHNVLLDEARKEFRRQKLSELVH*

RE43278.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL17-PB 176 CG13880-PB 1..176 1..176 910 100 Plus
mRpL17-PA 176 CG13880-PA 1..176 1..176 910 100 Plus