BDGP Sequence Production Resources |
Search the DGRC for RE43278
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 432 |
Well: | 78 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL17-RA |
Protein status: | RE43278.pep: gold |
Preliminary Size: | 504 |
Sequenced Size: | 761 |
Gene | Date | Evidence |
---|---|---|
CG13880 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13880 | 2002-06-07 | Blastp of sequenced clone |
CG13880 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL17 | 2008-04-29 | Release 5.5 accounting |
mRpL17 | 2008-08-15 | Release 5.9 accounting |
mRpL17 | 2008-12-18 | 5.12 accounting |
761 bp (761 high quality bases) assembled on 2002-06-07
GenBank Submission: AY119639
> RE43278.complete AAATGGTCGCCAGCTGTTCGGCGAATGTTACGTGATTTCCTATTTGTAAC ATTGCTAAAAATCGAGTAAAATGAATCAAGCCGATGTAACAAAGCTCATG TCACAGCTGCGTATAGCGGTCAGGCCCAACAAGCGCCATCTGAAGAATGT CGATGGCCCGGAAGGTCGGCTGCTGAAGCTGCGTAAGACCGTCACTGCGT TGGTGAAGCACGAGCGTATTGAACTGTTCTACAACCGTGCCGATGAAGCT CGTGGCTACGCCGAACTGCTCATTTCCAATGCCATACGCCATGGGGACCG ACACCAAGCCACCATGGAACTGGCGGACTATTGGCTGCTGGAAAAGCAAC TGGTTCATAAGCTCTTCAAGGTGCTGGTACCGCGCTATGAGACTTACAAT GTGTCCTACACTCGCATGTACAAAGCCCCTCGGGAGTATCCTGGCATTTA CTACAGGCGGTCTGTGCTGGAGCTTCGGGGCAATCCCTACCCTTCGCTGG CGGCGGATCATTCTCAGAACCGGAATCTGCTGCACAATGTGCTTCTGGAC GAGGCGAGAAAGGAGTTTAGGCGTCAAAAACTGTCGGAGTTAGTTCACTA ATAGCTCTTTTCACTAACCGCCTGTTTATTTAGTAGATTAGCAAGCAGTT TGTCGCTTAGAATTCACGTAAGACTTAAAAGCATCTTTATTATAAATGTA TGTATACACAAAACGAATTGTTTGAATTAAGAGTTGAACTTATACAAAAA AAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 264736..265003 | 1..268 | 100 | -> | Plus |
chr3L | 265066..265542 | 269..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..531 | 71..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..531 | 71..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..531 | 71..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..531 | 71..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..531 | 71..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..745 | 1..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..745 | 1..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 4..748 | 1..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 1..745 | 1..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL17-RA | 4..748 | 1..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 264782..265049 | 1..268 | 100 | -> | Plus |
3L | 265112..265588 | 269..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 264782..265049 | 1..268 | 100 | -> | Plus |
3L | 265112..265588 | 269..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 264782..265049 | 1..268 | 100 | -> | Plus |
3L | 265112..265588 | 269..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 264782..265049 | 1..268 | 100 | -> | Plus |
arm_3L | 265112..265588 | 269..745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 264782..265049 | 1..268 | 100 | -> | Plus |
3L | 265112..265588 | 269..745 | 100 | Plus |
Translation from 70 to 600
> RE43278.pep MNQADVTKLMSQLRIAVRPNKRHLKNVDGPEGRLLKLRKTVTALVKHERI ELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQLVHKLFK VLVPRYETYNVSYTRMYKAPREYPGIYYRRSVLELRGNPYPSLAADHSQN RNLLHNVLLDEARKEFRRQKLSELVH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25043-PA | 176 | GF25043-PA | 1..176 | 1..176 | 802 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14709-PA | 177 | GG14709-PA | 1..176 | 1..176 | 890 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15737-PA | 197 | GH15737-PA | 1..176 | 1..176 | 795 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL17-PB | 176 | CG13880-PB | 1..176 | 1..176 | 910 | 100 | Plus |
mRpL17-PA | 176 | CG13880-PA | 1..176 | 1..176 | 910 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12794-PA | 215 | GI12794-PA | 1..176 | 1..176 | 827 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16123-PA | 176 | GL16123-PA | 1..175 | 1..175 | 827 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28391-PA | 176 | GA28391-PA | 1..175 | 1..175 | 827 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14324-PA | 176 | GM14324-PA | 1..176 | 1..176 | 904 | 98.3 | Plus |
Dsec\GM23092-PA | 71 | GM23092-PA | 1..67 | 1..67 | 336 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11005-PA | 176 | GD11005-PA | 1..176 | 1..176 | 904 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16093-PA | 324 | GJ16093-PA | 1..176 | 1..176 | 802 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16542-PA | 201 | GK16542-PA | 1..176 | 1..176 | 815 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21072-PA | 177 | GE21072-PA | 1..176 | 1..176 | 884 | 94.9 | Plus |
Translation from 70 to 600
> RE43278.hyp MNQADVTKLMSQLRIAVRPNKRHLKNVDGPEGRLLKLRKTVTALVKHERI ELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQLVHKLFK VLVPRYETYNVSYTRMYKAPREYPGIYYRRSVLELRGNPYPSLAADHSQN RNLLHNVLLDEARKEFRRQKLSELVH*