Clone RE43371 Report

Search the DGRC for RE43371

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:433
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG14265-RB
Protein status:RE43371.pep: gold
Preliminary Size:566
Sequenced Size:568

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14265 2002-01-01 Sim4 clustering to Release 2
CG14265 2002-04-26 Blastp of sequenced clone
CG14265 2003-01-01 Sim4 clustering to Release 3
CG14265 2008-04-29 Release 5.5 accounting
CG14265 2008-08-15 Release 5.9 accounting
CG14265 2008-12-18 5.12 accounting

Clone Sequence Records

RE43371.complete Sequence

568 bp (568 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113473

> RE43371.complete
ATCCAGTCTTTCGATTAACTTTGACTCAATATGAAGCTCCACTGGCTGCT
ATTAGCAGTCGTACTGATCTGTGCCCTGTACAGCGCTACGGGCACCAGCC
CCACCACGGAAACCAGCACCAGCACCGAGTCGACCACCGCTACGGGCTCA
AGCACTTCGACAACCTCGGCCAGCACCTCCTCCTCATCCTCGGACACCAC
CGAGGCCAGCAGCAGCAGCAGCGATTCGTCCACCAGTTCCAGCAGCTCGT
CCTCTAGCTCCAGCAGTTCATCCAAGAAGAAGGCTGCCGCCAGAAGGAGG
CGTGCCGCTCGCAGGAGGCGTCGTGCCGCACGCAGGAGACGTGCTGCTGC
CGCTCGCAGGCGCGCCCAGCGCAGGCGCAACAGGGGTTAGACTGGAAACC
GCGATTGGAGGGGGGTGGGGGAATCCACTAGAATCCACTTGAATCCACCC
ATTCCGGCCTAGACAGGACTTTCAACGTTTTTTTTTTTCCAACACTCTCT
GTTGATCCTCGGGATCGCCAATTTAATATATTCCCGGCTATGGTTATTGC
ATGAAAAAAAAAAAAAAA

RE43371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-RB 559 CG14265-RB 1..558 1..558 2790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3129738..3130297 553..1 2535 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3236125..3236682 558..1 2790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3244223..3244780 558..1 2790 100 Minus
Blast to na_te.dros performed 2019-03-16 05:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 6568..6612 506..462 108 71.1 Minus

RE43371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:31 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3129738..3130297 1..553 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:10 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..360 31..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:21 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..360 31..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:30:16 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..360 31..390 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:13 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..360 31..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:13 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..360 31..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:08 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..553 1..553 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:21 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..553 1..553 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:16 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 5..557 1..553 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:14 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 1..553 1..553 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:13 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 5..557 1..553 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:31 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
X 3236130..3236682 1..553 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:31 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
X 3236130..3236682 1..553 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:31 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
X 3236130..3236682 1..553 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:16 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3130163..3130715 1..553 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:13 Download gff for RE43371.complete
Subject Subject Range Query Range Percent Splice Strand
X 3244228..3244780 1..553 100   Minus

RE43371.pep Sequence

Translation from 30 to 389

> RE43371.pep
MKLHWLLLAVVLICALYSATGTSPTTETSTSTESTTATGSSTSTTSASTS
SSSSDTTEASSSSSDSSTSSSSSSSSSSSSSKKKAAARRRRAARRRRRAA
RRRRAAAARRRAQRRRNRG*

RE43371.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-PB 119 CG14265-PB 1..119 1..119 556 100 Plus
CG14453-PA 133 CG14453-PA 1..117 1..118 238 49.2 Plus
CG14454-PB 120 CG14454-PB 1..103 1..118 205 46.6 Plus
CG14454-PA 120 CG14454-PA 1..103 1..118 205 46.6 Plus
CG32453-PB 120 CG32453-PB 1..103 1..118 205 46.6 Plus
CG32453-PA 120 CG32453-PA 1..103 1..118 205 46.6 Plus
CG13560-PB 181 CG13560-PB 78..180 19..116 197 50.5 Plus
CG13560-PA 181 CG13560-PA 78..180 19..116 197 50.5 Plus
CG12546-PA 117 CG12546-PA 1..109 1..118 192 40.7 Plus
CG14452-PA 117 CG14452-PA 1..109 1..118 192 40.7 Plus
CG14852-PA 174 CG14852-PA 67..164 22..118 184 47.1 Plus
CG14453-PA 133 CG14453-PA 44..125 18..118 181 45.1 Plus
CG12491-PA 157 CG12491-PA 12..145 10..118 181 41 Plus
CG34105-PA 157 CG34105-PA 12..145 10..118 181 41 Plus
CG12491-PA 157 CG12491-PA 45..148 18..118 175 38.5 Plus
CG34105-PA 157 CG34105-PA 45..148 18..118 175 38.5 Plus
CG32071-PA 150 CG32071-PA 19..130 6..119 171 38.7 Plus
CG3918-PA 321 CG3918-PA 203..298 23..118 169 36.5 Plus
CG14850-PA 158 CG14850-PA 50..154 19..118 164 40 Plus
CG12491-PA 157 CG12491-PA 54..155 18..118 162 38.8 Plus
CG34105-PA 157 CG34105-PA 54..155 18..118 162 38.8 Plus
CG12522-PA 137 CG12522-PA 9..110 6..114 161 39.1 Plus
CG34273-PA 128 CG34273-PA 1..124 1..114 154 37.1 Plus
CG15741-PA 135 CG15741-PA 31..132 19..118 148 37.5 Plus
CG15741-PA 135 CG15741-PA 1..127 1..118 146 30.5 Plus
ng3-PB 146 CG10788-PB 7..144 6..102 143 35.5 Plus
ng2-PA 112 CG14266-PA 8..111 6..113 140 35.2 Plus
CG11300-PA 157 CG11300-PA 45..140 19..119 138 40.8 Plus
ng1-PA 107 CG10781-PA 8..104 6..115 137 33.6 Plus
ng2-PA 112 CG14266-PA 5..108 11..118 136 32.1 Plus
CG9040-PA 161 CG9040-PA 40..127 26..108 136 39.8 Plus
CG32198-PB 136 CG32198-PB 4..120 2..119 135 33.9 Plus

RE43371.hyp Sequence

Translation from 30 to 389

> RE43371.hyp
MKLHWLLLAVVLICALYSATGTSPTTETSTSTESTTATGSSTSTTSASTS
SSSSDTTEASSSSSDSSTSSSSSSSSSSSSSKKKAAARRRRAARRRRRAA
RRRRAAAARRRAQRRRNRG*

RE43371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-PB 119 CG14265-PB 1..119 1..119 556 100 Plus
CG14453-PA 133 CG14453-PA 1..117 1..118 238 49.2 Plus
CG32453-PB 120 CG32453-PB 1..103 1..118 205 46.6 Plus
CG32453-PA 120 CG32453-PA 1..103 1..118 205 46.6 Plus
CG14454-PB 120 CG14454-PB 1..103 1..118 205 46.6 Plus
CG14453-PA 133 CG14453-PA 44..125 18..118 181 45.1 Plus