Clone RE43665 Report

Search the DGRC for RE43665

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:436
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG9344-RA
Protein status:RE43665.pep: gold
Preliminary Size:240
Sequenced Size:490

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9344 2002-01-01 Sim4 clustering to Release 2
CG9344 2002-04-26 Blastp of sequenced clone
CG9344 2003-01-01 Sim4 clustering to Release 3
CG9344 2008-04-29 Release 5.5 accounting
CG9344 2008-08-15 Release 5.9 accounting
CG9344 2008-12-18 5.12 accounting

Clone Sequence Records

RE43665.complete Sequence

490 bp (490 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113474

> RE43665.complete
ATTGTCGGCATAAAATAACAACTGTATTCACATTTGTTATTTATTATTGC
TGCCAAAAGGTTTTGTAAACTGCATTTATTTTGAAATCATCTATTGAAAA
TGTCCCGCAAAGAGGCCCTGTCGCAGTTCATCAATCAGATACACGGACGC
CCCGTCGCCGTAAAGCTGAACAACGGCGTTGACTATCGAGGTGTGCTGGC
CTGTCTGGATGGCTACATGAACATCTGCCTGGAGCAGACGGAGGAGTACG
TGAATGGGCAGCTGAAGAACAAGTACGGCGACGCCTTCATCCGCGGCAAC
AATGTCCTCTACATTTCCACGCAGAAGCGGAGGGTCTGAATACAGGAGGG
TCTCAACTGGCATGGCACCATGAAGTTCGTAGTTAGAGAACTCTGATTCC
TCTGTTTCCTTCAGAGGGAACCTGCGACAACACAAGTGTTTCATACTTCA
ATATTAAAGCTGAACCAACTTCACAAAAAAAAAAAAAAAA

RE43665.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 692 CG9344-RA 49..520 1..472 2345 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16863770..16864053 189..472 1345 98.2 Plus
chr2R 21145070 chr2R 16863511..16863703 1..193 890 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977598 189..472 1420 100 Plus
2R 25286936 2R 20977056..20977248 1..193 950 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20978514..20978797 189..472 1420 100 Plus
2R 25260384 2R 20978255..20978447 1..193 950 99.4 Plus
Blast to na_te.dros performed 2019-03-16 02:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 232..289 112 67.8 Plus
Stalker4 7359 Stalker4 STALKER4 7359bp 5516..5557 103..63 108 76.2 Minus
Stalker 7256 Stalker STALKER 7256bp 5410..5451 103..63 108 76.2 Minus

RE43665.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:33 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16863511..16863700 1..190 97 -> Plus
chr2R 16863772..16864055 191..474 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:15 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 100..339 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:31 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 100..339 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:18 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 100..339 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:41 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 100..339 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:02 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 100..339 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:48 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..471 1..471 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:31 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..474 1..474 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:18 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..474 1..474 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:41 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..471 1..471 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:02 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..474 1..474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:33 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20977056..20977245 1..190 99 -> Plus
2R 20977317..20977600 191..474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:33 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20977056..20977245 1..190 99 -> Plus
2R 20977317..20977600 191..474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:33 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20977056..20977245 1..190 99 -> Plus
2R 20977317..20977600 191..474 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:18 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864561..16864750 1..190 99 -> Plus
arm_2R 16864822..16865105 191..474 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:32 Download gff for RE43665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20978255..20978444 1..190 99 -> Plus
2R 20978516..20978799 191..474 99   Plus

RE43665.pep Sequence

Translation from 99 to 338

> RE43665.pep
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEY
VNGQLKNKYGDAFIRGNNVLYISTQKRRV*

RE43665.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12211-PA 79 GF12211-PA 1..79 1..79 414 100 Plus
Dana\GF12081-PA 88 GF12081-PA 12..74 10..72 160 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22072-PA 79 GG22072-PA 1..79 1..79 414 100 Plus
Dere\GG22599-PA 88 GG22599-PA 12..74 10..72 160 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22008-PA 79 GH22008-PA 1..79 1..79 404 97.5 Plus
Dgri\GH22983-PA 88 GH22983-PA 12..74 10..72 160 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 79 CG9344-PA 1..79 1..79 412 100 Plus
SmF-PA 88 CG16792-PA 12..74 10..72 161 49.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19714-PA 79 GI19714-PA 1..79 1..79 404 97.5 Plus
Dmoj\GI18952-PA 88 GI18952-PA 12..74 10..72 160 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17007-PA 79 GL17007-PA 1..79 1..79 414 100 Plus
Dper\GL11267-PA 88 GL11267-PA 12..74 10..72 160 49.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21716-PA 79 GA21716-PA 1..79 1..79 414 100 Plus
Dpse\GA14154-PA 88 GA14154-PA 12..74 10..72 160 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15790-PA 79 GM15790-PA 1..79 1..79 414 100 Plus
Dsec\GM20378-PA 88 GM20378-PA 12..74 10..72 160 49.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11551-PA 79 GD11551-PA 1..79 1..79 414 100 Plus
Dsim\DebB-PA 88 GD15242-PA 12..74 10..72 160 49.2 Plus
Dsim\GD15243-PA 88 GD15243-PA 12..74 10..72 160 49.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17501-PA 79 GJ17501-PA 1..79 1..79 404 97.5 Plus
Dvir\GJ21558-PA 88 GJ21558-PA 12..74 10..72 160 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23338-PA 79 GK23338-PA 1..79 1..79 414 100 Plus
Dwil\GK22120-PA 88 GK22120-PA 12..74 10..72 160 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12153-PA 79 GE12153-PA 1..79 1..79 414 100 Plus
Dyak\GE13467-PA 88 GE13467-PA 12..74 10..72 160 49.2 Plus

RE43665.hyp Sequence

Translation from 99 to 338

> RE43665.hyp
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEY
VNGQLKNKYGDAFIRGNNVLYISTQKRRV*

RE43665.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 79 CG9344-PA 1..79 1..79 412 100 Plus
SmF-PA 88 CG16792-PA 12..74 10..72 161 49.2 Plus