BDGP Sequence Production Resources |
Search the DGRC for RE43724
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 437 |
Well: | 24 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Arpc4-RA |
Protein status: | RE43724.pep: gold |
Preliminary Size: | 612 |
Sequenced Size: | 722 |
Gene | Date | Evidence |
---|---|---|
CG5972 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5972 | 2002-04-26 | Blastp of sequenced clone |
CG5972 | 2003-01-01 | Sim4 clustering to Release 3 |
Arc-p20 | 2008-04-29 | Release 5.5 accounting |
Arc-p20 | 2008-08-15 | Release 5.9 accounting |
Arc-p20 | 2008-12-18 | 5.12 accounting |
722 bp (722 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113475
> RE43724.complete ACATCTTTTCTGGTTGATAAATTCCAGGGCCTGTGAATCATAATAAGTTA AGTAAAAAGTGCAGATACAACAAACCGCAGGCAGCAGACAACAACCCGAC ACCCAGACACAATGGCAGCCACATTGAAGCCCTACCTGACCGCCGTGCGA CACTCGCTGACGGCGGCGATGTGCCTGCAGGACTTCCCCTCGCAGGTGGT GGAGCGGCACAACAAGCCGGAGGTGGAGATCTGTTCCAGCAAGGAGCTGG TGCTCACGCCCGTCGTCGTGTCGCGCAACGAGCGGGAGAAGGTGCTGATC GAGCCGTCCATTAACTCGGTGCGCGTGAGCATCGCCGTGAAGCAGGCCGA CGAGATTGAGCGCATACTGTGCCACAAGTTCACCAGGTTCATGATGCGAC GCGCCGAGTCGTTCGTCATACTGCGCCGCAAGCCCATCGAGGGCTACGAC ATAAGCTTCCTCATCACCAACTTCCACACGGAGCAGATGTATAAGCACAA ACTGGTGGACTTTGTCATTAGCTTCATGGAGGAGATCGACAAGGAGATCA GCGAAATGAAACTGGCGGTCAATGCCAGGGCACGCACCTGCGCCGAGGAG TTCCTCAAACGGTTCTAGGTGAAGGCAACCAGTATGGACCCGGTCATGAT GCTTTAGTATTTCCAAATGGATTCAAGAATAAAGACGGATTTTGTATTAT TTACCCAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 6124189..6124806 | 1..618 | 100 | -> | Plus |
chr2L | 6124875..6124962 | 619..706 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..507 | 112..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..507 | 112..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc4-RA | 1..507 | 112..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..507 | 112..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc4-RA | 1..507 | 112..618 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..706 | 1..706 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..706 | 1..706 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc4-RA | 7..712 | 1..706 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arc-p20-RA | 1..706 | 1..706 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc4-RA | 7..712 | 1..706 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6125138..6125755 | 1..618 | 100 | -> | Plus |
2L | 6125824..6125911 | 619..706 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6125138..6125755 | 1..618 | 100 | -> | Plus |
2L | 6125824..6125911 | 619..706 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6125138..6125755 | 1..618 | 100 | -> | Plus |
2L | 6125824..6125911 | 619..706 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 6125138..6125755 | 1..618 | 100 | -> | Plus |
arm_2L | 6125824..6125911 | 619..706 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6125138..6125755 | 1..618 | 100 | -> | Plus |
2L | 6125824..6125911 | 619..706 | 98 | Plus |
Translation from 111 to 617
> RE43724.hyp MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTP VVVSRNEREKVLIEPSINSVRVSIAVKQADEIERILCHKFTRFMMRRAES FVILRRKPIEGYDISFLITNFHTEQMYKHKLVDFVISFMEEIDKEISEMK LAVNARARTCAEEFLKRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Arpc4-PA | 168 | CG5972-PA | 1..168 | 1..168 | 844 | 100 | Plus |
Translation from 111 to 617
> RE43724.pep MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTP VVVSRNEREKVLIEPSINSVRVSIAVKQADEIERILCHKFTRFMMRRAES FVILRRKPIEGYDISFLITNFHTEQMYKHKLVDFVISFMEEIDKEISEMK LAVNARARTCAEEFLKRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14506-PA | 168 | GF14506-PA | 1..168 | 1..168 | 874 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10390-PA | 168 | GG10390-PA | 1..168 | 1..168 | 875 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20063-PA | 168 | GH20063-PA | 1..168 | 1..168 | 873 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Arpc4-PA | 168 | CG5972-PA | 1..168 | 1..168 | 844 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18781-PA | 168 | GI18781-PA | 1..168 | 1..168 | 873 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19069-PA | 168 | GL19069-PA | 1..168 | 1..168 | 858 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19270-PA | 168 | GA19270-PA | 1..168 | 1..168 | 858 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18606-PA | 168 | GM18606-PA | 1..168 | 1..168 | 875 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23389-PA | 168 | GD23389-PA | 1..168 | 1..168 | 875 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21807-PA | 168 | GJ21807-PA | 1..168 | 1..168 | 866 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14733-PA | 168 | GK14733-PA | 1..168 | 1..168 | 866 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13659-PA | 168 | GE13659-PA | 1..168 | 1..168 | 875 | 100 | Plus |