Clone RE43724 Report

Search the DGRC for RE43724

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:437
Well:24
Vector:pFlc-1
Associated Gene/TranscriptArpc4-RA
Protein status:RE43724.pep: gold
Preliminary Size:612
Sequenced Size:722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5972 2002-01-01 Sim4 clustering to Release 2
CG5972 2002-04-26 Blastp of sequenced clone
CG5972 2003-01-01 Sim4 clustering to Release 3
Arc-p20 2008-04-29 Release 5.5 accounting
Arc-p20 2008-08-15 Release 5.9 accounting
Arc-p20 2008-12-18 5.12 accounting

Clone Sequence Records

RE43724.complete Sequence

722 bp (722 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113475

> RE43724.complete
ACATCTTTTCTGGTTGATAAATTCCAGGGCCTGTGAATCATAATAAGTTA
AGTAAAAAGTGCAGATACAACAAACCGCAGGCAGCAGACAACAACCCGAC
ACCCAGACACAATGGCAGCCACATTGAAGCCCTACCTGACCGCCGTGCGA
CACTCGCTGACGGCGGCGATGTGCCTGCAGGACTTCCCCTCGCAGGTGGT
GGAGCGGCACAACAAGCCGGAGGTGGAGATCTGTTCCAGCAAGGAGCTGG
TGCTCACGCCCGTCGTCGTGTCGCGCAACGAGCGGGAGAAGGTGCTGATC
GAGCCGTCCATTAACTCGGTGCGCGTGAGCATCGCCGTGAAGCAGGCCGA
CGAGATTGAGCGCATACTGTGCCACAAGTTCACCAGGTTCATGATGCGAC
GCGCCGAGTCGTTCGTCATACTGCGCCGCAAGCCCATCGAGGGCTACGAC
ATAAGCTTCCTCATCACCAACTTCCACACGGAGCAGATGTATAAGCACAA
ACTGGTGGACTTTGTCATTAGCTTCATGGAGGAGATCGACAAGGAGATCA
GCGAAATGAAACTGGCGGTCAATGCCAGGGCACGCACCTGCGCCGAGGAG
TTCCTCAAACGGTTCTAGGTGAAGGCAACCAGTATGGACCCGGTCATGAT
GCTTTAGTATTTCCAAATGGATTCAAGAATAAAGACGGATTTTGTATTAT
TTACCCAAAAAAAAAAAAAAAA

RE43724.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Arc-p20-RA 846 Arc-p20-RA 121..824 1..704 3520 100 Plus
WDR79-RA 1723 WDR79-RA 1687..1723 704..668 185 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6124189..6124808 1..620 3100 100 Plus
chr2L 23010047 chr2L 6124873..6124960 617..704 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6125138..6125757 1..620 3100 100 Plus
2L 23513712 2L 6125822..6125909 617..704 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6125138..6125757 1..620 3100 100 Plus
2L 23513712 2L 6125822..6125909 617..704 440 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:03:44 has no hits.

RE43724.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:04:49 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6124189..6124806 1..618 100 -> Plus
chr2L 6124875..6124962 619..706 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:16 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..507 112..618 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:27 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..507 112..618 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:54 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc4-RA 1..507 112..618 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:06 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..507 112..618 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:46:14 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc4-RA 1..507 112..618 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:31:26 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:27 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:54 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc4-RA 7..712 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:06 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p20-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:46:14 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc4-RA 7..712 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:49 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6125138..6125755 1..618 100 -> Plus
2L 6125824..6125911 619..706 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:49 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6125138..6125755 1..618 100 -> Plus
2L 6125824..6125911 619..706 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:49 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6125138..6125755 1..618 100 -> Plus
2L 6125824..6125911 619..706 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:54 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6125138..6125755 1..618 100 -> Plus
arm_2L 6125824..6125911 619..706 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:30:49 Download gff for RE43724.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6125138..6125755 1..618 100 -> Plus
2L 6125824..6125911 619..706 98   Plus

RE43724.hyp Sequence

Translation from 111 to 617

> RE43724.hyp
MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTP
VVVSRNEREKVLIEPSINSVRVSIAVKQADEIERILCHKFTRFMMRRAES
FVILRRKPIEGYDISFLITNFHTEQMYKHKLVDFVISFMEEIDKEISEMK
LAVNARARTCAEEFLKRF*

RE43724.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc4-PA 168 CG5972-PA 1..168 1..168 844 100 Plus

RE43724.pep Sequence

Translation from 111 to 617

> RE43724.pep
MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTP
VVVSRNEREKVLIEPSINSVRVSIAVKQADEIERILCHKFTRFMMRRAES
FVILRRKPIEGYDISFLITNFHTEQMYKHKLVDFVISFMEEIDKEISEMK
LAVNARARTCAEEFLKRF*

RE43724.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14506-PA 168 GF14506-PA 1..168 1..168 874 99.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10390-PA 168 GG10390-PA 1..168 1..168 875 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20063-PA 168 GH20063-PA 1..168 1..168 873 98.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc4-PA 168 CG5972-PA 1..168 1..168 844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18781-PA 168 GI18781-PA 1..168 1..168 873 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19069-PA 168 GL19069-PA 1..168 1..168 858 97.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19270-PA 168 GA19270-PA 1..168 1..168 858 97.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18606-PA 168 GM18606-PA 1..168 1..168 875 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23389-PA 168 GD23389-PA 1..168 1..168 875 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21807-PA 168 GJ21807-PA 1..168 1..168 866 98.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14733-PA 168 GK14733-PA 1..168 1..168 866 97.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13659-PA 168 GE13659-PA 1..168 1..168 875 100 Plus