Clone RE43931 Report

Search the DGRC for RE43931

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:439
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG6055-RA
Protein status:RE43931.pep: gold
Preliminary Size:781
Sequenced Size:1096

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6055 2002-01-01 Sim4 clustering to Release 2
CG6055 2002-06-10 Blastp of sequenced clone
CG6055 2003-01-01 Sim4 clustering to Release 3
CG6055 2008-04-29 Release 5.5 accounting
CG6055 2008-08-15 Release 5.9 accounting
CG6055 2008-12-18 5.12 accounting

Clone Sequence Records

RE43931.complete Sequence

1096 bp (1096 high quality bases) assembled on 2002-06-10

GenBank Submission: BT001650

> RE43931.complete
AGTTGGTATAAGTGAATCGTTGCGTGCGGTTGTTCCCACAACAACATTTT
AAGCTTGGATATCTGTGCTGTTCGCTTATCGAGTTTTGAGCCCCGCTTTG
TGTCGTTCGTTTCAATCTAAAGCTATCCAAATATGTCTGTGCTGCGTGCA
CTGATGTTTCTGGCCTTTGGTGCCACCGTGGCGCTGGCCCAACGTCGCCT
GGCTCTGCCCGATCCGAGGAGTTGCGCCAACCGGGTGCGCCATGCCAGCT
ATCGGGATGCCAGGGGCGTGTCCCACTCGTACTTCTTCAGCTGGGAGCAT
GCTCCTACCCGCAGCCTGGAGGTGGATTGGCTGGATGCGAGGAACATCTG
CCGCAGGCACTGCATGGATGCCGTTTCCCTGGAGACGCCACAGGAGAATG
ACTTTGTGAAGCAGAGGATTGCCAGGGGCAATGTGCGATACATTTGGACC
TCGGGCAGGAAGTGCAACTTCGCTGGCTGCGACAGGCCCGATCTGCAGCC
TCCCAATGAGAACGGTTGGTTCTGGTCGGGATCGGGGGCAAAGATTGGAC
CCACTTCGCAGAGGAACACCGGCGATTGGTCTTCAACGGGCGGATACCAA
CAGCCGCAGCCCGATAACCGGGAGGCCGCGCAGGGCAACGACGAGAGCTG
CCTGTCCATCCTGAACAACTTCTACAACGATGGCATCAAGTGGCACGACG
TGGCCTGCCATCACATCAAGCCATTTGTGTGCGAGGACTCCGATGAGCTG
TTGAACTTCGTCCGCTCCCGGAACCCCAATGTCCGCTTGTAATTCTAACT
AGCCTAAGCCTGAGGGAGATGATTAAAATTTACATATTTATGTAGCCTTA
AACGGAACATTAATTGGTTGATTGATTGATTGATTGTTTGATTCAAATTC
ATTGACTATTCAATCCAACATTGATGACTTCCAAAACGCGTAACATTCGT
TTGTTCGGTTAGTTCGCAGCAAAAGTTCTATAAGCAAAATTTGTAATAAC
ATTTCTGTGTCGATCCGCGCATCATAAACAAAATTGTTAAATAATTTTAA
AAATTGTTAATAAATACAAATTGAACCCATAAAAAAAAAAAAAAAA

RE43931.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6055-RA 1135 CG6055-RA 54..1135 1..1082 5410 100 Plus
CG6055.b 982 CG6055.b 23..982 121..1080 4800 100 Plus
CG6055.a 1031 CG6055.a 73..1031 122..1080 4795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7470574..7471540 114..1080 4730 99.3 Plus
chr2L 23010047 chr2L 7465611..7465732 1..122 610 100 Plus
chr3R 27901430 chr3R 8185752..8185821 317..386 185 84.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7471534..7472496 121..1083 4815 100 Plus
2L 23513712 2L 7466550..7466671 1..122 610 100 Plus
3R 32079331 3R 12360375..12360444 317..386 185 84.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7471534..7472496 121..1083 4815 100 Plus
2L 23513712 2L 7466550..7466671 1..122 610 100 Plus
3R 31820162 3R 12101206..12101275 317..386 185 84.2 Plus
3R 31820162 3R 12103634..12103744 670..780 180 77.4 Plus
Blast to na_te.dros performed on 2019-03-16 13:41:04 has no hits.

RE43931.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:42:07 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7465611..7465732 1..122 100 -> Plus
chr2L 7470583..7471540 123..1080 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:21 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 1..660 133..792 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:58 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 1..660 133..792 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:28:58 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 1..660 133..792 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:25 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 1..660 133..792 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:54 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 1..660 133..792 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:54:08 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 5..1084 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:58 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 5..1084 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:28:58 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 8..1087 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:25 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 5..1084 1..1080 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:54 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
CG6055-RA 8..1087 1..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:07 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7466550..7466671 1..122 100 -> Plus
2L 7471536..7472493 123..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:07 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7466550..7466671 1..122 100 -> Plus
2L 7471536..7472493 123..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:07 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7466550..7466671 1..122 100 -> Plus
2L 7471536..7472493 123..1080 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:28:58 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7466550..7466671 1..122 100 -> Plus
arm_2L 7471536..7472493 123..1080 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:44 Download gff for RE43931.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7471536..7472493 123..1080 100   Plus
2L 7466550..7466671 1..122 100 -> Plus

RE43931.pep Sequence

Translation from 132 to 791

> RE43931.pep
MSVLRALMFLAFGATVALAQRRLALPDPRSCANRVRHASYRDARGVSHSY
FFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGN
VRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDWS
STGGYQQPQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHIKPFVC
EDSDELLNFVRSRNPNVRL*

RE43931.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15862-PA 219 GF15862-PA 1..219 1..219 1059 95 Plus
Dana\GF17242-PA 220 GF17242-PA 11..220 6..219 646 55.3 Plus
Dana\GF14419-PA 231 GF14419-PA 32..231 21..219 502 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10482-PA 219 GG10482-PA 1..219 1..219 1168 98.6 Plus
Dere\GG18750-PA 220 GG18750-PA 11..220 6..219 650 56.3 Plus
Dere\GG24353-PA 231 GG24353-PA 32..231 21..219 498 48.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11170-PA 219 GH11170-PA 1..219 1..219 1130 95 Plus
Dgri\GH22097-PA 220 GH22097-PA 14..220 9..219 641 55.7 Plus
Dgri\GH10241-PA 190 GH10241-PA 1..188 1..174 319 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6055-PB 219 CG6055-PB 1..219 1..219 1209 100 Plus
CG6055-PA 219 CG6055-PA 1..219 1..219 1209 100 Plus
CG4115-PA 220 CG4115-PA 26..220 22..219 666 59.3 Plus
Clect27-PB 231 CG3244-PB 32..231 21..219 509 48.5 Plus
Clect27-PA 231 CG3244-PA 32..231 21..219 509 48.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23788-PA 219 GI23788-PA 1..219 1..219 1138 95.9 Plus
Dmoj\GI22702-PA 220 GI22702-PA 26..220 22..219 642 58.3 Plus
Dmoj\GI15343-PA 233 GI15343-PA 1..233 1..219 506 45.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25820-PA 219 GL25820-PA 1..219 1..219 1066 95.4 Plus
Dper\GL22277-PA 220 GL22277-PA 12..220 7..219 639 55.1 Plus
Dper\GL15967-PA 232 GL15967-PA 33..232 21..219 497 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19326-PA 219 GA19326-PA 1..219 1..219 1066 95.4 Plus
Dpse\GA17968-PA 220 GA17968-PA 12..220 7..219 639 55.1 Plus
Dpse\GA16905-PA 246 GA16905-PA 47..246 21..219 501 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16469-PA 219 GM16469-PA 1..219 1..219 1174 99.5 Plus
Dsec\GM24013-PA 220 GM24013-PA 11..220 6..219 652 56.3 Plus
Dsec\GM18074-PA 231 GM18074-PA 32..231 21..219 498 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23474-PA 219 GD23474-PA 1..219 1..219 1170 99.1 Plus
Dsim\GD18814-PA 220 GD18814-PA 11..220 6..219 652 56.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21003-PA 219 GJ21003-PA 1..219 1..219 1131 95.4 Plus
Dvir\GJ23431-PA 220 GJ23431-PA 26..220 22..219 639 57.8 Plus
Dvir\GJ17272-PA 233 GJ17272-PA 1..233 1..219 499 45 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24308-PA 219 GK24308-PA 1..219 1..219 1129 95.4 Plus
Dwil\GK11972-PA 220 GK11972-PA 11..220 8..219 643 56.1 Plus
Dwil\GK23915-PA 233 GK23915-PA 34..233 21..219 504 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14572-PA 219 GE14572-PA 1..219 1..219 1168 98.6 Plus
Dyak\GE26172-PA 220 GE26172-PA 11..220 6..219 653 56.3 Plus
Dyak\GE14680-PA 231 GE14680-PA 32..231 21..219 498 48.5 Plus

RE43931.hyp Sequence

Translation from 132 to 791

> RE43931.hyp
MSVLRALMFLAFGATVALAQRRLALPDPRSCANRVRHASYRDARGVSHSY
FFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGN
VRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDWS
STGGYQQPQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHIKPFVC
EDSDELLNFVRSRNPNVRL*

RE43931.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6055-PB 219 CG6055-PB 1..219 1..219 1209 100 Plus
CG6055-PA 219 CG6055-PA 1..219 1..219 1209 100 Plus
CG4115-PA 220 CG4115-PA 26..220 22..219 666 59.3 Plus
Clect27-PB 231 CG3244-PB 32..231 21..219 509 48.5 Plus
Clect27-PA 231 CG3244-PA 32..231 21..219 509 48.5 Plus