Clone RE44027 Report

Search the DGRC for RE44027

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:440
Well:27
Vector:pFlc-1
Associated Gene/TranscriptNnf1b-RA
Protein status:RE44027.pep: gold
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31658 2003-01-01 Sim4 clustering to Release 3
CG31658 2004-08-13 Blastp of sequenced clone
Nnf1b 2008-04-29 Release 5.5 accounting
Nnf1b 2008-08-15 Release 5.9 accounting
Nnf1b 2008-12-18 5.12 accounting

Clone Sequence Records

RE44027.complete Sequence

789 bp (789 high quality bases) assembled on 2004-08-13

GenBank Submission: BT015998

> RE44027.complete
ATGGTTTCGGTCGCCAAGTTTTGCTTGTAATTATTATTTTGCCAGAATTG
TGTTAAAAGTATGAATAATATTGAAGAGGACACCGAAGCAGCCTTCAAAC
GGCTCCAGGCTGTCATTCCACAGGTGAAGCAGGCCTACGAGGAAGCCATT
GGACAGATCTTCTCGGATTTAAACTCCTCAGATCTTGAGTCGTGTGCCTC
CATCCTCGAGGAGCACGAATCCACGAGCCTGGACACCGAGCAAATAATCC
ACAGCACCCGTCGGCTTATGACCAAGATCGTCCTGGATGTGAACCAGTGC
TTCTTCTCCGGCAACGACGTGGAGACCAAGCTGACCACGCTGGAAATGCT
TAAGGAGCAGTTTGCCGCCCACGAGGGCAAGAACTGGAACTTCAACTGTC
TGTCCCCTGAGGAACTTACTCGCCCTCTGCGCATGCACAACTTGAATCTA
AGCATCACATTCATGGAGCAACAGCTTAAGAAACAGGAAAAGGAACTCGA
GATTGCTATGGCCAAAAGCATTAAAAATCGACAGCTTATACATGATGTCC
ACGCTGAACGGGTGAAAGTGGGATGTATGATGAAGCAGCAGTTGGCCGAG
TACCAGGCCATTAAGCCACAGTTAATGGAAATGGAACGGCTAATAAATGA
TTCGTATGTGCAGGAAGAAATGTAATTTTATAAAAAAAAACAGATTATTA
TTATTATTATTATTATTATTATTATTATTATATTAGTTGCTGGGTCTTGA
AATAAATATGAATTTCAAACTTAGAAAAAAAAAAAAAAA

RE44027.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1b-RA 787 Nnf1b-RA 73..787 1..715 3560 99.8 Plus
Nnf1a-RA 787 Nnf1a-RA 206..249 118..161 145 88.6 Plus
Nnf1a-RA 787 Nnf1a-RA 429..478 341..390 145 86 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 811132..811406 500..773 1325 99.6 Plus
chr2L 23010047 chr2L 810684..810897 174..387 1055 99.5 Plus
chr2L 23010047 chr2L 810461..810633 1..173 820 98.3 Plus
chr2L 23010047 chr2L 810963..811078 386..501 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 811257..811530 500..773 1370 100 Plus
2L 23513712 2L 810809..811022 174..387 1070 100 Plus
2L 23513712 2L 810586..810758 1..173 850 99.4 Plus
2L 23513712 2L 811088..811203 386..501 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 811257..811530 500..773 1370 100 Plus
2L 23513712 2L 810809..811022 174..387 1070 100 Plus
2L 23513712 2L 810586..810758 1..173 850 99.4 Plus
2L 23513712 2L 811088..811203 386..501 580 100 Plus
Blast to na_te.dros performed 2019-03-16 12:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 985..1085 771..673 122 59.4 Minus
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 3235..3311 68..147 113 65.4 Plus

RE44027.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:24:35 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 810461..810633 1..173 98 -> Plus
chr2L 810684..810896 174..386 99 -> Plus
chr2L 810964..811078 387..501 100 -> Plus
chr2L 811134..811406 502..774 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:24 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:18 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:18:00 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:09 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:44:58 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:28 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:18 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..773 1..774 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:18:00 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 10..782 1..774 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:09 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 1..615 61..675 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:44:58 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
Nnf1b-RA 10..782 1..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:35 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
2L 810586..810758 1..173 99 -> Plus
2L 810809..811021 174..386 100 -> Plus
2L 811089..811203 387..501 100 -> Plus
2L 811259..811530 502..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:35 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
2L 810586..810758 1..173 99 -> Plus
2L 810809..811021 174..386 100 -> Plus
2L 811089..811203 387..501 100 -> Plus
2L 811259..811530 502..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:35 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
2L 810586..810758 1..173 99 -> Plus
2L 810809..811021 174..386 100 -> Plus
2L 811089..811203 387..501 100 -> Plus
2L 811259..811530 502..774 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:18:00 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 810586..810758 1..173 99 -> Plus
arm_2L 810809..811021 174..386 100 -> Plus
arm_2L 811089..811203 387..501 100 -> Plus
arm_2L 811259..811530 502..774 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:06 Download gff for RE44027.complete
Subject Subject Range Query Range Percent Splice Strand
2L 810809..811021 174..386 100 -> Plus
2L 811089..811203 387..501 100 -> Plus
2L 811259..811530 502..774 99   Plus
2L 810586..810758 1..173 99 -> Plus

RE44027.pep Sequence

Translation from 60 to 674

> RE44027.pep
MNNIEEDTEAAFKRLQAVIPQVKQAYEEAIGQIFSDLNSSDLESCASILE
EHESTSLDTEQIIHSTRRLMTKIVLDVNQCFFSGNDVETKLTTLEMLKEQ
FAAHEGKNWNFNCLSPEELTRPLRMHNLNLSITFMEQQLKKQEKELEIAM
AKSIKNRQLIHDVHAERVKVGCMMKQQLAEYQAIKPQLMEMERLINDSYV
QEEM*

RE44027.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12757-PA 208 GF12757-PA 12..202 8..198 433 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24745-PA 204 GG24745-PA 1..203 1..203 912 83.3 Plus
Dere\GG20848-PA 189 GG20848-PA 2..185 6..189 588 58.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22114-PA 203 GH22114-PA 11..196 5..195 368 41.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1b-PA 204 CG31658-PA 1..204 1..204 1035 100 Plus
Nnf1a-PA 194 CG13434-PA 2..193 6..197 574 57.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19249-PA 164 GI19249-PA 6..155 42..191 349 44.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17439-PA 217 GL17439-PA 11..210 6..200 498 47.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24826-PA 217 GA24826-PA 11..210 6..200 495 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16767-PA 200 GM16767-PA 1..200 1..200 1020 96 Plus
Dsec\GM19776-PA 194 GM19776-PA 2..193 6..197 594 55.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23046-PA 200 GD23046-PA 1..200 1..200 1023 96 Plus
Dsim\GD25267-PA 194 GD25267-PA 2..193 6..197 597 56.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20326-PA 206 GJ20326-PA 11..204 5..198 417 42.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21831-PA 199 GK21831-PA 7..192 7..192 447 46.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17078-PA 204 GE17078-PA 1..204 1..204 931 83.8 Plus
Dyak\GE13787-PA 194 GE13787-PA 2..193 6..197 591 56.8 Plus

RE44027.hyp Sequence

Translation from 60 to 674

> RE44027.hyp
MNNIEEDTEAAFKRLQAVIPQVKQAYEEAIGQIFSDLNSSDLESCASILE
EHESTSLDTEQIIHSTRRLMTKIVLDVNQCFFSGNDVETKLTTLEMLKEQ
FAAHEGKNWNFNCLSPEELTRPLRMHNLNLSITFMEQQLKKQEKELEIAM
AKSIKNRQLIHDVHAERVKVGCMMKQQLAEYQAIKPQLMEMERLINDSYV
QEEM*

RE44027.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Nnf1b-PA 204 CG31658-PA 1..204 1..204 1035 100 Plus
Nnf1a-PA 194 CG13434-PA 2..193 6..197 574 57.3 Plus