Clone RE44119 Report

Search the DGRC for RE44119

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:441
Well:19
Vector:pFlc-1
Associated Gene/TranscriptRpS17-RB
Protein status:RE44119.pep: gold
Sequenced Size:543

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3922 2002-10-30 Blastp of sequenced clone
RpS17 2008-04-29 Release 5.5 accounting
RpS17 2008-08-15 Release 5.9 accounting
RpS17 2008-12-18 5.12 accounting

Clone Sequence Records

RE44119.complete Sequence

543 bp (543 high quality bases) assembled on 2002-10-30

GenBank Submission: BT001651

> RE44119.complete
CTTTTTCTTTCGTTTCCGGCGAGCGGTGATTAAAATATCCATCGAGCAAC
ATAATGGGTCGCGTACGAACCAAGACGGTGAAGAAGGCCGCTAAGGTCAT
CATCGAGAAGTACTACACTCGCCTGACGTTGGACTTCCACACCAACAAGC
GCATCTGCGAGGAGGTGGCCATCATTCCCACCAAGCCCCTGCGCAACAAG
ATTGCCGGCTATGTCACCCATTTGATGGGCCGCCTGCGTCACTCCCAGGT
GCGTGGTATCTCCATCAAGTTGCAGGAGGAGGAGCGTGAGCGTCGTGACA
ACTACGTCCCGGCCGTCTCCGCTCTGGAGCAGGACATCATCGAGGTCGAC
GCCGACACCAAGGAGATGTTGAAGCTTCTGGACTTCCACAACATCCGTGG
CCTGCAGCTCACCCAGCCCAACACCAACAACTTTGGTCGTCGCAACTAAG
ATTTGTATAGCGCGTAGATGATGATGTTCTGATTTGCATGGGATCACAAT
AAATTTGTGTGAAGTGCATTTAAAGTGTAAAAAAAAAAAAAAA

RE44119.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpS17-RB 810 RpS17-RB 41..569 1..529 2645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9420709..9421029 528..208 1575 99.4 Minus
chr3L 24539361 chr3L 9421088..9421240 208..56 750 99.3 Minus
chr3L 24539361 chr3L 9421597..9421632 57..22 180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9428794..9429115 529..208 1610 100 Minus
3L 28110227 3L 9429174..9429326 208..56 765 100 Minus
3L 28110227 3L 9429694..9429729 57..22 180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9421894..9422215 529..208 1610 100 Minus
3L 28103327 3L 9422274..9422426 208..56 765 100 Minus
3L 28103327 3L 9422794..9422829 57..22 180 100 Minus
Blast to na_te.dros performed 2019-03-16 19:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 4758..4830 289..363 109 62.7 Plus

RE44119.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:36 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9420709..9421028 209..528 99 <- Minus
chr3L 9421088..9421239 57..208 99 <- Minus
chr3L 9421598..9421630 24..56 100 <- Minus
chr3L 9421695..9421717 1..23 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:29 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 1..396 54..449 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:37 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 1..396 54..449 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:56 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 1..396 54..449 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:59:24 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 1..396 54..449 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:03:09 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 1..396 54..449 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:10 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 4..531 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:37 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 4..531 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:56 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 8..535 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:59:25 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 4..531 1..528 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:03:09 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
RpS17-RB 8..535 1..528 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:36 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9428795..9429114 209..528 100 <- Minus
3L 9429174..9429325 57..208 100 <- Minus
3L 9429695..9429727 24..56 100 <- Minus
3L 9429792..9429814 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:36 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9428795..9429114 209..528 100 <- Minus
3L 9429174..9429325 57..208 100 <- Minus
3L 9429695..9429727 24..56 100 <- Minus
3L 9429792..9429814 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:36 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9428795..9429114 209..528 100 <- Minus
3L 9429174..9429325 57..208 100 <- Minus
3L 9429695..9429727 24..56 100 <- Minus
3L 9429792..9429814 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:56 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9421895..9422214 209..528 100 <- Minus
arm_3L 9422274..9422425 57..208 100 <- Minus
arm_3L 9422795..9422827 24..56 100 <- Minus
arm_3L 9422892..9422914 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:00 Download gff for RE44119.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9421895..9422214 209..528 100 <- Minus
3L 9422274..9422425 57..208 100 <- Minus
3L 9422795..9422827 24..56 100 <- Minus
3L 9422892..9422914 1..23 100   Minus

RE44119.hyp Sequence

Translation from 53 to 448

> RE44119.hyp
MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKI
AGYVTHLMGRLRHSQVRGISIKLQEEERERRDNYVPAVSALEQDIIEVDA
DTKEMLKLLDFHNIRGLQLTQPNTNNFGRRN*

RE44119.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpS17-PB 131 CG3922-PB 1..131 1..131 668 100 Plus

RE44119.pep Sequence

Translation from 53 to 448

> RE44119.pep
MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKI
AGYVTHLMGRLRHSQVRGISIKLQEEERERRDNYVPAVSALEQDIIEVDA
DTKEMLKLLDFHNIRGLQLTQPNTNNFGRRN*

RE44119.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25156-PA 131 GF25156-PA 1..131 1..131 684 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14040-PA 131 GG14040-PA 1..131 1..131 689 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16319-PA 132 GH16319-PA 3..132 2..131 684 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpS17-PB 131 CG3922-PB 1..131 1..131 668 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13264-PA 131 GI13264-PA 1..131 1..131 689 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22448-PA 131 GL22448-PA 1..131 1..131 680 97.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17776-PA 131 GA17776-PA 1..131 1..131 680 97.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24873-PA 131 GM24873-PA 1..131 1..131 689 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12925-PA 131 GD12925-PA 1..131 1..131 689 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12034-PA 133 GJ12034-PA 4..133 2..131 672 98.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16630-PA 135 GK16630-PA 6..135 2..131 677 99.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS17-PA 131 GE21243-PA 1..131 1..131 685 99.2 Plus