Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
RE44251.complete Sequence
1065 bp (1065 high quality bases) assembled on 2002-06-07
GenBank Submission: AY119643
> RE44251.complete
AAAAAGCAATGACTGATCAGCTGTCCAAAAACCTAAATAATAAATAATTT
GAATATTAATAAATAAATAAAGTTTTTAAGAAAATCTGGAGGAGCACAAA
TATTAGAAGAAAATTCAGAAAAACAAAGTCACTGTCAAAACACCATCAAA
TATGAACCGGACCCTGAAGATACAAATGAACAAATGATAAAGAATACAGA
ACATATTAAGGATAGATGTCAAAATTTCATAAAAACGGAAAATCCCACAG
ATTTATCTTATTCCCAGACTGGCTTATAAGAGGTAATTATGTTAGATGTT
AATGATCTGGTTAAGGAGGAGTTCGCCCTGGAGGATCCAAATGAGGAAGA
GCACAATCAAAGAGACGAGGAAGAGATAAGCTATCAATTGGCTGGCCAGC
CAAAAATGTGTTCTACGTGCTTGGAGGCTTTTCCCATCGACAACTTTTCA
TCTCACGCATGCTGGGACATCAATTGCGATCGATTCAGCTGCAAAATCTT
CCCTCGAAAGTTTCGTTACAAGTCATTGCTTAAAAAGCCACGTCAGACGG
CAAAAGGGCGAGAGCATAGCGGAACTGGATTTAGCGAAACCCACAGACTC
CAGGACCAAGCCCAACTTCGAGTTAAACTACTCACCCACTCCAAGGTGGA
AGATATCTCGACGGAGAGCTGGGATGCTGAAGCTCAACGAAATGCGTGTG
CATCAACAACGCCTGTGCCTCTATTGCCCCATTGCCTTCTCAAACGAATC
GCACCTGGAGAAGCACCTGAGGGATCACCATGCTGAGCGCCTTTATACAA
GCGAATTAATAACCCCAGATTTCGAGACTGATGGCTCAGAACGGATATGC
GTCAAATTAAACGAGGATGTAGCCTTTAGCTATTTAGTTCTATACAATCA
CTTGCAAGATTTTATCAAGGGGTATTCTCAAATTTATTTTAGTAATTTAA
TTAAAATAACTAAGCTGTAACGTTAGCAATATAAACGTTATATATATATA
TTGTTATTGTTTATTTGCTTCGTTTTGTTAATTATACAAAATATTTTTCA
AAAAAAAAAAAAAAA
RE44251.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:52:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14117.a | 1049 | CG14117.a | 1..1049 | 2..1049 | 5205 | 99.9 | Plus |
CG14117-RC | 1058 | CG14117-RC | 2..535 | 2..534 | 2630 | 99.8 | Plus |
CG14117-RB | 1113 | CG14117-RB | 597..1113 | 533..1049 | 2585 | 100 | Plus |
CG14117-RC | 1058 | CG14117-RC | 542..1058 | 533..1049 | 2585 | 100 | Plus |
CG14117-RB | 1113 | CG14117-RB | 2..284 | 2..283 | 1375 | 99.6 | Plus |
CG14117-RB | 1113 | CG14117-RB | 339..590 | 283..534 | 1260 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:33:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 12999225..12999743 | 535..1048 | 2345 | 98.1 | Plus |
chr3L | 24539361 | chr3L | 12998565..12998847 | 2..283 | 1365 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 12998901..12999147 | 284..530 | 1205 | 99.2 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13008936..13009453 | 535..1052 | 2590 | 100 | Plus |
3L | 28110227 | 3L | 13008285..13008567 | 2..283 | 1365 | 99.6 | Plus |
3L | 28110227 | 3L | 13008622..13008873 | 283..534 | 1260 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13002036..13002553 | 535..1052 | 2590 | 100 | Plus |
3L | 28103327 | 3L | 13001385..13001667 | 2..283 | 1375 | 99.6 | Plus |
3L | 28103327 | 3L | 13001722..13001973 | 283..534 | 1260 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 13:33:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\HeT-A | 5691 | Dyak\HeT-A YAKHETA 5691bp | 222..295 | 1049..980 | 116 | 67.6 | Minus |
Dhyd\Minos | 1773 | Dhyd\Minos DHMINOS 1773bp Derived from Z29098. | 1462..1512 | 973..923 | 111 | 68.6 | Minus |
RE44251.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:34:46 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 12998900..12999151 | 284..534 | 97 | -> | Plus |
chr3L | 12999225..12999716 | 535..1021 | 91 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:35 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RA | 1..231 | 289..519 | 100 | == | Plus |
CG14117-RA | 232..669 | 533..970 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:52 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RC | 1..690 | 289..970 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:02:05 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RD | 1..498 | 289..786 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:20:09 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RA | 1..231 | 289..519 | 100 | == | Plus |
CG14117-RA | 232..669 | 533..970 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:28 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RD | 1..498 | 289..786 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:59:26 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RA | 2..522 | 2..521 | 99 | == | Plus |
CG14117-RA | 523..1037 | 535..1049 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:52 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RC | 2..1058 | 2..1049 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:02:05 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RD | 1..1049 | 2..1049 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:20:09 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RA | 2..522 | 2..521 | 99 | == | Plus |
CG14117-RA | 523..1037 | 535..1049 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:28 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14117-RD | 1..1049 | 2..1049 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:46 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13008623..13008873 | 284..534 | 100 | -> | Plus |
3L | 13008284..13008567 | 1..283 | 99 | -> | Plus |
3L | 13008936..13009450 | 535..1049 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:46 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13008623..13008873 | 284..534 | 100 | -> | Plus |
3L | 13008284..13008567 | 1..283 | 99 | -> | Plus |
3L | 13008936..13009450 | 535..1049 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:46 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13008623..13008873 | 284..534 | 100 | -> | Plus |
3L | 13008284..13008567 | 1..283 | 99 | -> | Plus |
3L | 13008936..13009450 | 535..1049 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:02:05 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13001384..13001667 | 1..283 | 99 | -> | Plus |
arm_3L | 13001723..13001973 | 284..534 | 100 | -> | Plus |
arm_3L | 13002036..13002550 | 535..1049 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:47 Download gff for
RE44251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13001384..13001667 | 1..283 | 99 | -> | Plus |
3L | 13001723..13001973 | 284..534 | 100 | -> | Plus |
3L | 13002036..13002550 | 535..1049 | 100 | | Plus |
RE44251.pep Sequence
Translation from 288 to 785
> RE44251.pep
MLDVNDLVKEEFALEDPNEEEHNQRDEEEISYQLAGQPKMCSTCLEAFPI
DNFSSHACWDINCDRFSCKIFPRKFRYKSLLKKPRQTAKGREHSGTGFSE
THRLQDQAQLRVKLLTHSKVEDISTESWDAEAQRNACASTTPVPLLPHCL
LKRIAPGEAPEGSPC*
RE44251.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:20:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15615-PA | 191 | GG15615-PA | 1..81 | 1..82 | 263 | 73.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14117-PD | 165 | CG14117-PD | 1..165 | 1..165 | 891 | 100 | Plus |
CG14117-PE | 94 | CG14117-PE | 1..82 | 1..82 | 450 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:20:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25387-PA | 195 | GM25387-PA | 1..81 | 1..81 | 323 | 86.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:20:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14420-PA | 195 | GD14420-PA | 1..83 | 1..83 | 318 | 83.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:21:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21942-PA | 192 | GE21942-PA | 1..82 | 1..82 | 306 | 72 | Plus |
RE44251.hyp Sequence
Translation from 288 to 785
> RE44251.hyp
MLDVNDLVKEEFALEDPNEEEHNQRDEEEISYQLAGQPKMCSTCLEAFPI
DNFSSHACWDINCDRFSCKIFPRKFRYKSLLKKPRQTAKGREHSGTGFSE
THRLQDQAQLRVKLLTHSKVEDISTESWDAEAQRNACASTTPVPLLPHCL
LKRIAPGEAPEGSPC*
RE44251.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14117-PD | 165 | CG14117-PD | 1..165 | 1..165 | 891 | 100 | Plus |
CG14117-PE | 94 | CG14117-PE | 1..82 | 1..82 | 450 | 100 | Plus |