Clone RE44624 Report

Search the DGRC for RE44624

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:446
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCG31715-RA
Protein status:RE44624.pep: gold
Sequenced Size:590

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5025 2002-01-01 Sim4 clustering to Release 2
CG31715 2002-04-26 Blastp of sequenced clone
CG31715 2003-01-01 Sim4 clustering to Release 3
CG31715 2008-04-29 Release 5.5 accounting
CG31715 2008-08-15 Release 5.9 accounting
CG31715 2008-12-18 5.12 accounting

Clone Sequence Records

RE44624.complete Sequence

590 bp (590 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113479

> RE44624.complete
GTCACAGGCAAAGTTCCATCCCTAGCAGTATTTGACAAGTCGGCCCAAAA
GAAAAATAAAAATGAGTGCGATTTCTAATGAAGACATTATTTGGACCATA
AAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGATGCACA
AAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGCAGCAG
ATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAGCAGAC
ATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCCATTTG
GGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGCTGATA
AAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGGAAAAA
GACGAGATTAAGAAACTCCTTGCATAATATGTACATGTCATTTTAGGGTA
CAAACCTTATGTTTCAGTATCAAGTACACTTTTAAATACAGTCGTGTATA
GCTTTTAAAAATGTCAACTATTTATTTCGATGCTTTGGAAAAATTGATAC
AAAAATATTCCACTTTTATATAAACAAAAAAAAAAAAAAA

RE44624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 662 CG31715-RA 79..657 1..579 2880 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10341140..10341375 340..575 1165 99.6 Plus
chr2L 23010047 chr2L 10340473..10340618 1..146 715 99.3 Plus
chr2L 23010047 chr2L 10340674..10340784 146..256 555 100 Plus
chr2L 23010047 chr2L 10341002..10341086 257..341 425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10342288..10342527 340..579 1185 99.6 Plus
2L 23513712 2L 10341621..10341766 1..146 730 100 Plus
2L 23513712 2L 10341822..10341932 146..256 555 100 Plus
2L 23513712 2L 10342150..10342234 257..341 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10342288..10342527 340..579 1185 99.5 Plus
2L 23513712 2L 10341621..10341766 1..146 730 100 Plus
2L 23513712 2L 10341822..10341932 146..256 555 100 Plus
2L 23513712 2L 10342150..10342234 257..341 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:57:51 has no hits.

RE44624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:39 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10340473..10340617 1..145 99 -> Plus
chr2L 10340674..10340784 146..256 100 -> Plus
chr2L 10341002..10341085 257..340 100 -> Plus
chr2L 10341141..10341375 341..575 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:44 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 62..427 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:05 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 62..427 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:27 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 62..427 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:24 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 62..427 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:47:57 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 62..427 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:30 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..575 1..575 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:05 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..575 1..575 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:27 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 6..580 1..575 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:25 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..575 1..575 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:47:57 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 6..580 1..575 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:39 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10342289..10342523 341..575 99   Plus
2L 10341621..10341765 1..145 100 -> Plus
2L 10341822..10341932 146..256 100 -> Plus
2L 10342150..10342233 257..340 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:39 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10342289..10342523 341..575 99   Plus
2L 10341621..10341765 1..145 100 -> Plus
2L 10341822..10341932 146..256 100 -> Plus
2L 10342150..10342233 257..340 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:39 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10342289..10342523 341..575 99   Plus
2L 10341621..10341765 1..145 100 -> Plus
2L 10341822..10341932 146..256 100 -> Plus
2L 10342150..10342233 257..340 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:27 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10341621..10341765 1..145 100 -> Plus
arm_2L 10341822..10341932 146..256 100 -> Plus
arm_2L 10342150..10342233 257..340 100 -> Plus
arm_2L 10342289..10342523 341..575 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:16 Download gff for RE44624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10342289..10342523 341..575 99   Plus
2L 10341621..10341765 1..145 100 -> Plus
2L 10341822..10341932 146..256 100 -> Plus
2L 10342150..10342233 257..340 100 -> Plus

RE44624.pep Sequence

Translation from 61 to 426

> RE44624.pep
MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ
LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS
TPDGQSYLEAAEKDEIKKLLA*

RE44624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15769-PA 121 GF15769-PA 1..121 1..121 569 87.6 Plus
Dana\GF16011-PA 146 GF16011-PA 4..144 5..121 386 51.8 Plus
Dana\GF18240-PA 1178 GF18240-PA 484..582 5..100 144 35.4 Plus
Dana\GF23770-PA 1529 GF23770-PA 682..775 21..113 142 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10110-PA 121 GG10110-PA 1..121 1..121 597 92.6 Plus
Dere\GG12231-PA 1181 GG12231-PA 686..788 18..120 147 33 Plus
Dere\GG12231-PA 1181 GG12231-PA 484..582 5..100 141 35.4 Plus
Dere\GG14943-PA 1526 GG14943-PA 700..775 38..113 141 38.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13540-PA 123 GH13540-PA 1..121 1..121 517 76 Plus
Dgri\GH22750-PA 125 GH22750-PA 4..119 5..120 430 67.2 Plus
Dgri\GH16856-PA 1546 GH16856-PA 682..775 21..113 153 37.2 Plus
Dgri\GH18604-PA 1202 GH18604-PA 482..580 5..100 148 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 121 CG31715-PA 1..121 1..121 625 100 Plus
CG31715-PB 119 CG31715-PB 1..119 1..121 602 98.3 Plus
CG7423-PA 124 CG7423-PA 8..122 7..121 397 61.7 Plus
Tnks-PA 1181 CG4719-PA 686..788 18..120 148 33 Plus
Tnks-PB 1520 CG4719-PB 686..788 18..120 148 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10598-PA 121 GI10598-PA 1..121 1..121 524 78.5 Plus
Dmoj\GI21091-PA 125 GI21091-PA 4..119 5..120 407 63.8 Plus
Dmoj\GI10353-PA 1185 GI10353-PA 482..580 5..100 155 36.4 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 682..775 21..113 150 36.2 Plus
Dmoj\GI10353-PA 1185 GI10353-PA 684..786 18..120 141 32 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18996-PA 117 GL18996-PA 2..116 6..120 500 79.1 Plus
Dper\GL14660-PA 127 GL14660-PA 8..121 7..120 367 57 Plus
Dper\GL22305-PA 1187 GL22305-PA 492..581 14..100 144 37.8 Plus
Dper\GL22305-PA 1187 GL22305-PA 685..787 18..120 142 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22482-PA 117 GA22482-PA 2..116 6..120 500 79.1 Plus
Dpse\GA20339-PA 336 GA20339-PA 8..121 7..120 374 57.9 Plus
Dpse\GA18382-PA 1189 GA18382-PA 492..581 14..100 144 37.8 Plus
Dpse\GA18382-PA 1189 GA18382-PA 685..787 18..120 142 32 Plus
Dpse\GA23604-PA 1519 GA23604-PA 682..775 21..113 142 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18191-PA 121 GM18191-PA 1..121 1..121 609 95.9 Plus
Dsec\GM22773-PA 124 GM22773-PA 8..122 7..121 348 54.8 Plus
Dsec\GM10230-PA 1181 GM10230-PA 686..788 18..120 146 33 Plus
Dsec\GM23234-PA 1543 GM23234-PA 539..638 14..113 145 36 Plus
Dsec\GM10230-PA 1181 GM10230-PA 484..582 5..100 141 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23680-PA 121 GD23680-PA 1..121 1..121 609 95.9 Plus
Dsim\GD15607-PA 88 GD15607-PA 4..86 39..121 292 59 Plus
Dsim\GD18183-PA 1181 GD18183-PA 686..788 18..120 146 33 Plus
Dsim\GD18183-PA 1181 GD18183-PA 484..582 5..100 141 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17533-PA 123 GJ17533-PA 1..121 1..121 517 76.9 Plus
Dvir\GJ20938-PA 125 GJ20938-PA 4..119 5..120 428 67.2 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 688..781 21..113 150 36.2 Plus
Dvir\GJ10205-PA 1187 GJ10205-PA 482..580 5..100 148 36.4 Plus
Dvir\GJ10205-PA 1187 GJ10205-PA 684..786 18..120 141 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25099-PA 125 GK25099-PA 6..122 4..120 411 62.4 Plus
Dwil\GK14394-PA 1495 GK14394-PA 700..802 18..120 142 32 Plus
Dwil\GK14394-PA 1495 GK14394-PA 498..596 5..100 141 35.4 Plus
Dwil\GK24225-PA 1516 GK24225-PA 682..775 21..113 141 34 Plus
Dwil\GK16311-PA 263 GK16311-PA 140..249 18..120 140 31 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18925-PA 121 GE18925-PA 1..121 1..121 587 90.9 Plus
Dyak\GE10679-PA 1181 GE10679-PA 686..788 18..120 146 33 Plus
Dyak\GE10679-PA 1181 GE10679-PA 484..582 5..100 141 35.4 Plus
Dyak\GE20395-PA 1535 GE20395-PA 700..775 38..113 141 38.2 Plus

RE44624.hyp Sequence

Translation from 61 to 426

> RE44624.hyp
MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ
LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS
TPDGQSYLEAAEKDEIKKLLA*

RE44624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 121 CG31715-PA 1..121 1..121 625 100 Plus
CG31715-PB 119 CG31715-PB 1..119 1..121 602 98.3 Plus
CG7423-PA 124 CG7423-PA 8..122 7..121 397 61.7 Plus
Tnks-PA 1181 CG4719-PA 686..788 18..120 148 33 Plus
Tnks-PB 1520 CG4719-PB 686..788 18..120 148 33 Plus