BDGP Sequence Production Resources |
Search the DGRC for RE44624
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 446 |
Well: | 24 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG31715-RA |
Protein status: | RE44624.pep: gold |
Sequenced Size: | 590 |
Gene | Date | Evidence |
---|---|---|
CG5025 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31715 | 2002-04-26 | Blastp of sequenced clone |
CG31715 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31715 | 2008-04-29 | Release 5.5 accounting |
CG31715 | 2008-08-15 | Release 5.9 accounting |
CG31715 | 2008-12-18 | 5.12 accounting |
590 bp (590 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113479
> RE44624.complete GTCACAGGCAAAGTTCCATCCCTAGCAGTATTTGACAAGTCGGCCCAAAA GAAAAATAAAAATGAGTGCGATTTCTAATGAAGACATTATTTGGACCATA AAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGATGCACA AAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGCAGCAG ATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAGCAGAC ATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCCATTTG GGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGCTGATA AAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGGAAAAA GACGAGATTAAGAAACTCCTTGCATAATATGTACATGTCATTTTAGGGTA CAAACCTTATGTTTCAGTATCAAGTACACTTTTAAATACAGTCGTGTATA GCTTTTAAAAATGTCAACTATTTATTTCGATGCTTTGGAAAAATTGATAC AAAAATATTCCACTTTTATATAAACAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31715-RA | 662 | CG31715-RA | 79..657 | 1..579 | 2880 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10341140..10341375 | 340..575 | 1165 | 99.6 | Plus |
chr2L | 23010047 | chr2L | 10340473..10340618 | 1..146 | 715 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 10340674..10340784 | 146..256 | 555 | 100 | Plus |
chr2L | 23010047 | chr2L | 10341002..10341086 | 257..341 | 425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10342288..10342527 | 340..579 | 1185 | 99.6 | Plus |
2L | 23513712 | 2L | 10341621..10341766 | 1..146 | 730 | 100 | Plus |
2L | 23513712 | 2L | 10341822..10341932 | 146..256 | 555 | 100 | Plus |
2L | 23513712 | 2L | 10342150..10342234 | 257..341 | 425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10342288..10342527 | 340..579 | 1185 | 99.5 | Plus |
2L | 23513712 | 2L | 10341621..10341766 | 1..146 | 730 | 100 | Plus |
2L | 23513712 | 2L | 10341822..10341932 | 146..256 | 555 | 100 | Plus |
2L | 23513712 | 2L | 10342150..10342234 | 257..341 | 425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10340473..10340617 | 1..145 | 99 | -> | Plus |
chr2L | 10340674..10340784 | 146..256 | 100 | -> | Plus |
chr2L | 10341002..10341085 | 257..340 | 100 | -> | Plus |
chr2L | 10341141..10341375 | 341..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..366 | 62..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..366 | 62..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..366 | 62..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..366 | 62..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..366 | 62..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..575 | 1..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..575 | 1..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 6..580 | 1..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 1..575 | 1..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31715-RA | 6..580 | 1..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10342289..10342523 | 341..575 | 99 | Plus | |
2L | 10341621..10341765 | 1..145 | 100 | -> | Plus |
2L | 10341822..10341932 | 146..256 | 100 | -> | Plus |
2L | 10342150..10342233 | 257..340 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10342289..10342523 | 341..575 | 99 | Plus | |
2L | 10341621..10341765 | 1..145 | 100 | -> | Plus |
2L | 10341822..10341932 | 146..256 | 100 | -> | Plus |
2L | 10342150..10342233 | 257..340 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10342289..10342523 | 341..575 | 99 | Plus | |
2L | 10341621..10341765 | 1..145 | 100 | -> | Plus |
2L | 10341822..10341932 | 146..256 | 100 | -> | Plus |
2L | 10342150..10342233 | 257..340 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10341621..10341765 | 1..145 | 100 | -> | Plus |
arm_2L | 10341822..10341932 | 146..256 | 100 | -> | Plus |
arm_2L | 10342150..10342233 | 257..340 | 100 | -> | Plus |
arm_2L | 10342289..10342523 | 341..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10342289..10342523 | 341..575 | 99 | Plus | |
2L | 10341621..10341765 | 1..145 | 100 | -> | Plus |
2L | 10341822..10341932 | 146..256 | 100 | -> | Plus |
2L | 10342150..10342233 | 257..340 | 100 | -> | Plus |
Translation from 61 to 426
> RE44624.pep MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS TPDGQSYLEAAEKDEIKKLLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15769-PA | 121 | GF15769-PA | 1..121 | 1..121 | 569 | 87.6 | Plus |
Dana\GF16011-PA | 146 | GF16011-PA | 4..144 | 5..121 | 386 | 51.8 | Plus |
Dana\GF18240-PA | 1178 | GF18240-PA | 484..582 | 5..100 | 144 | 35.4 | Plus |
Dana\GF23770-PA | 1529 | GF23770-PA | 682..775 | 21..113 | 142 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10110-PA | 121 | GG10110-PA | 1..121 | 1..121 | 597 | 92.6 | Plus |
Dere\GG12231-PA | 1181 | GG12231-PA | 686..788 | 18..120 | 147 | 33 | Plus |
Dere\GG12231-PA | 1181 | GG12231-PA | 484..582 | 5..100 | 141 | 35.4 | Plus |
Dere\GG14943-PA | 1526 | GG14943-PA | 700..775 | 38..113 | 141 | 38.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13540-PA | 123 | GH13540-PA | 1..121 | 1..121 | 517 | 76 | Plus |
Dgri\GH22750-PA | 125 | GH22750-PA | 4..119 | 5..120 | 430 | 67.2 | Plus |
Dgri\GH16856-PA | 1546 | GH16856-PA | 682..775 | 21..113 | 153 | 37.2 | Plus |
Dgri\GH18604-PA | 1202 | GH18604-PA | 482..580 | 5..100 | 148 | 36.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31715-PA | 121 | CG31715-PA | 1..121 | 1..121 | 625 | 100 | Plus |
CG31715-PB | 119 | CG31715-PB | 1..119 | 1..121 | 602 | 98.3 | Plus |
CG7423-PA | 124 | CG7423-PA | 8..122 | 7..121 | 397 | 61.7 | Plus |
Tnks-PA | 1181 | CG4719-PA | 686..788 | 18..120 | 148 | 33 | Plus |
Tnks-PB | 1520 | CG4719-PB | 686..788 | 18..120 | 148 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10598-PA | 121 | GI10598-PA | 1..121 | 1..121 | 524 | 78.5 | Plus |
Dmoj\GI21091-PA | 125 | GI21091-PA | 4..119 | 5..120 | 407 | 63.8 | Plus |
Dmoj\GI10353-PA | 1185 | GI10353-PA | 482..580 | 5..100 | 155 | 36.4 | Plus |
Dmoj\GI13078-PA | 1540 | GI13078-PA | 682..775 | 21..113 | 150 | 36.2 | Plus |
Dmoj\GI10353-PA | 1185 | GI10353-PA | 684..786 | 18..120 | 141 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18996-PA | 117 | GL18996-PA | 2..116 | 6..120 | 500 | 79.1 | Plus |
Dper\GL14660-PA | 127 | GL14660-PA | 8..121 | 7..120 | 367 | 57 | Plus |
Dper\GL22305-PA | 1187 | GL22305-PA | 492..581 | 14..100 | 144 | 37.8 | Plus |
Dper\GL22305-PA | 1187 | GL22305-PA | 685..787 | 18..120 | 142 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22482-PA | 117 | GA22482-PA | 2..116 | 6..120 | 500 | 79.1 | Plus |
Dpse\GA20339-PA | 336 | GA20339-PA | 8..121 | 7..120 | 374 | 57.9 | Plus |
Dpse\GA18382-PA | 1189 | GA18382-PA | 492..581 | 14..100 | 144 | 37.8 | Plus |
Dpse\GA18382-PA | 1189 | GA18382-PA | 685..787 | 18..120 | 142 | 32 | Plus |
Dpse\GA23604-PA | 1519 | GA23604-PA | 682..775 | 21..113 | 142 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18191-PA | 121 | GM18191-PA | 1..121 | 1..121 | 609 | 95.9 | Plus |
Dsec\GM22773-PA | 124 | GM22773-PA | 8..122 | 7..121 | 348 | 54.8 | Plus |
Dsec\GM10230-PA | 1181 | GM10230-PA | 686..788 | 18..120 | 146 | 33 | Plus |
Dsec\GM23234-PA | 1543 | GM23234-PA | 539..638 | 14..113 | 145 | 36 | Plus |
Dsec\GM10230-PA | 1181 | GM10230-PA | 484..582 | 5..100 | 141 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23680-PA | 121 | GD23680-PA | 1..121 | 1..121 | 609 | 95.9 | Plus |
Dsim\GD15607-PA | 88 | GD15607-PA | 4..86 | 39..121 | 292 | 59 | Plus |
Dsim\GD18183-PA | 1181 | GD18183-PA | 686..788 | 18..120 | 146 | 33 | Plus |
Dsim\GD18183-PA | 1181 | GD18183-PA | 484..582 | 5..100 | 141 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17533-PA | 123 | GJ17533-PA | 1..121 | 1..121 | 517 | 76.9 | Plus |
Dvir\GJ20938-PA | 125 | GJ20938-PA | 4..119 | 5..120 | 428 | 67.2 | Plus |
Dvir\GJ13827-PA | 1548 | GJ13827-PA | 688..781 | 21..113 | 150 | 36.2 | Plus |
Dvir\GJ10205-PA | 1187 | GJ10205-PA | 482..580 | 5..100 | 148 | 36.4 | Plus |
Dvir\GJ10205-PA | 1187 | GJ10205-PA | 684..786 | 18..120 | 141 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25099-PA | 125 | GK25099-PA | 6..122 | 4..120 | 411 | 62.4 | Plus |
Dwil\GK14394-PA | 1495 | GK14394-PA | 700..802 | 18..120 | 142 | 32 | Plus |
Dwil\GK14394-PA | 1495 | GK14394-PA | 498..596 | 5..100 | 141 | 35.4 | Plus |
Dwil\GK24225-PA | 1516 | GK24225-PA | 682..775 | 21..113 | 141 | 34 | Plus |
Dwil\GK16311-PA | 263 | GK16311-PA | 140..249 | 18..120 | 140 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18925-PA | 121 | GE18925-PA | 1..121 | 1..121 | 587 | 90.9 | Plus |
Dyak\GE10679-PA | 1181 | GE10679-PA | 686..788 | 18..120 | 146 | 33 | Plus |
Dyak\GE10679-PA | 1181 | GE10679-PA | 484..582 | 5..100 | 141 | 35.4 | Plus |
Dyak\GE20395-PA | 1535 | GE20395-PA | 700..775 | 38..113 | 141 | 38.2 | Plus |
Translation from 61 to 426
> RE44624.hyp MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS TPDGQSYLEAAEKDEIKKLLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31715-PA | 121 | CG31715-PA | 1..121 | 1..121 | 625 | 100 | Plus |
CG31715-PB | 119 | CG31715-PB | 1..119 | 1..121 | 602 | 98.3 | Plus |
CG7423-PA | 124 | CG7423-PA | 8..122 | 7..121 | 397 | 61.7 | Plus |
Tnks-PA | 1181 | CG4719-PA | 686..788 | 18..120 | 148 | 33 | Plus |
Tnks-PB | 1520 | CG4719-PB | 686..788 | 18..120 | 148 | 33 | Plus |