Clone RE44650 Report

Search the DGRC for RE44650

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:446
Well:50
Vector:pFlc-1
Associated Gene/TranscriptCG11562-RA
Protein status:RE44650.pep: gold
Preliminary Size:623
Sequenced Size:717

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11562 2002-01-01 Sim4 clustering to Release 2
CG11562 2002-06-07 Blastp of sequenced clone
CG11562 2003-01-01 Sim4 clustering to Release 3
CG11562 2008-04-29 Release 5.5 accounting
CG11562 2008-08-15 Release 5.9 accounting
CG11562 2008-12-18 5.12 accounting

Clone Sequence Records

RE44650.complete Sequence

717 bp (717 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119645

> RE44650.complete
ATGTCGTAACCCGAACCGACTTCAAAACAACACAACCCGACAGCCAAATT
CCTAGTGCAGGCATTTTAGGCGGAAATCTCCAGCGGCAGACCGGTGCCCA
GTCATGTCGACCGCTTCGCGAGTGACTTTGGGACTGGCGGTCTCCATTTC
CACAGCGATCATAGGTTATGTGCACTATAAACAATCGGCAGACCGCCTGA
GACTGCACGATGGTGTCCTGAGGGACGTTGAGCAGCAACAACGGCGCAAA
CACGAGAATACCTACACGCTGCAGCAGCAAATAGACATGACCAAGCAACT
GAAAGCCAGGGAGGCGTCTAGCAACTCCTCTGACACGCCCGTACCTCCAT
CGACGCATCGCGCACAGAGTAATCTTCAAGCGGAGAAGCCAGCAGTGCAA
AATGAAGGCGAGGCTTTCAGAGGTGTTCCTCAGGGTGGAACGACTAATCA
CGATGGAAGCCCGCCAACTGACATAGCTTGATCACAAATATGCCCCTAAA
TATGCACCTATTAAAATCTAAGACTAAGTCGGGGAAAACAAGAATTTCGT
TGTTCAAATGTACGCATTTTTGAAGATTTTAAGATTTCGTCTTAAGACAG
TTGACAGCATCATTTACGCTGTTGATCGTTTTCAGTTGGTGAAGCCATCT
GCGCATGGAAATATAATTAAAACAACGTGGTAAGATTCAATCTTACAAAG
CAAAAAAAAAAAAAAAA

RE44650.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-RA 880 CG11562-RA 142..846 1..705 3510 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 292752..293258 195..701 2505 99.6 Plus
chr2L 23010047 chr2L 292502..292696 1..195 975 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 292716..293226 195..705 2540 99.8 Plus
2L 23513712 2L 292466..292660 1..195 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 292716..293226 195..705 2540 99.8 Plus
2L 23513712 2L 292466..292660 1..195 975 100 Plus
Blast to na_te.dros performed 2019-03-16 13:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tirant 8526 Tirant TIRANT 8526bp 6942..6984 580..538 116 74.4 Minus

RE44650.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:44:10 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 292502..292696 1..195 100 -> Plus
chr2L 292753..293258 196..701 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:48 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..378 104..481 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:01 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..378 104..481 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:34:23 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..378 104..481 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:25:58 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..378 104..481 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:09 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..378 104..481 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:48:47 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:01 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:34:23 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 48..748 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:25:58 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:09 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 48..748 1..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:10 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 292466..292660 1..195 100 -> Plus
2L 292717..293222 196..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:10 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 292466..292660 1..195 100 -> Plus
2L 292717..293222 196..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:10 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 292466..292660 1..195 100 -> Plus
2L 292717..293222 196..701 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:34:23 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 292466..292660 1..195 100 -> Plus
arm_2L 292717..293222 196..701 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:14 Download gff for RE44650.complete
Subject Subject Range Query Range Percent Splice Strand
2L 292717..293222 196..701 100   Plus
2L 292466..292660 1..195 100 -> Plus

RE44650.pep Sequence

Translation from 103 to 480

> RE44650.pep
MSTASRVTLGLAVSISTAIIGYVHYKQSADRLRLHDGVLRDVEQQQRRKH
ENTYTLQQQIDMTKQLKAREASSNSSDTPVPPSTHRAQSNLQAEKPAVQN
EGEAFRGVPQGGTTNHDGSPPTDIA*

RE44650.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20633-PA 164 GF20633-PA 1..104 1..94 350 68.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24710-PA 125 GG24710-PA 1..125 1..125 566 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11547-PA 90 GH11547-PA 1..88 1..81 305 67 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-PA 125 CG11562-PA 1..125 1..125 637 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17036-PA 83 GI17036-PA 1..68 1..68 305 85.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25923-PA 119 GL25923-PA 1..100 1..97 332 68 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11067-PA 119 GA11067-PA 1..100 1..97 332 68 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16941-PA 125 GM16941-PA 1..125 1..125 636 96.8 Plus
Dsec\GM16730-PA 125 GM16730-PA 1..125 1..125 636 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23014-PA 125 GD23014-PA 1..125 1..125 640 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24677-PA 115 GJ24677-PA 1..68 1..68 291 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15299-PA 149 GK15299-PA 1..73 1..73 321 79.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16714-PA 116 GE16714-PA 1..116 1..125 513 82.4 Plus

RE44650.hyp Sequence

Translation from 103 to 480

> RE44650.hyp
MSTASRVTLGLAVSISTAIIGYVHYKQSADRLRLHDGVLRDVEQQQRRKH
ENTYTLQQQIDMTKQLKAREASSNSSDTPVPPSTHRAQSNLQAEKPAVQN
EGEAFRGVPQGGTTNHDGSPPTDIA*

RE44650.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-PA 125 CG11562-PA 1..125 1..125 637 100 Plus