Clone RE44854 Report

Search the DGRC for RE44854

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:448
Well:54
Vector:pFlc-1
Associated Gene/TranscriptKaz-m1-RA
Protein status:RE44854.pep: gold
Preliminary Size:660
Sequenced Size:683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8342 2002-01-01 Sim4 clustering to Release 2
CG8342 2002-04-26 Blastp of sequenced clone
CG8342 2003-01-01 Sim4 clustering to Release 3
m1 2008-04-29 Release 5.5 accounting
m1 2008-08-15 Release 5.9 accounting
m1 2008-12-18 5.12 accounting

Clone Sequence Records

RE44854.complete Sequence

683 bp (683 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113480

> RE44854.complete
TGACCAATTGAAATCGATAGCTACTACAGAGAGAACGCATTCGTCTGTAA
AAACCCAAAAAGTAAAAACGAAAGTAAAAAAACAACTTCAAAATGATGAG
CCAAACTTTGACCCTTTGCTGCCTTGCATTGGTGGCATGTGTATACGGAA
ATACAGTGTCCACCAACGATACCGCTTGTCCAACTTTTTGCCCCAGTATC
TACAAGCCAGTATGCGGAACTGATGGCCAGAACTTCAAGGAGTTTGCTAG
CACCTGCAATCTTTTGTCCCACAACTGTCGCCGCGAAAGGAATAGCGTGC
AGGCCTATGCTGCCACCGATGCCGCCTGGTGCAGCTCCGAGTTCGTCGAG
AATCTGCACGAGAAGTTGGGCAACTTCAAGCTGGAGGTCAAGGAATGCTT
CAAGCCCTGCTCGATGATCTACCAGCCGGTGTGCATTACCAATGGAAAGT
ATCGTGCCGAGTTGGCCAACTCCTGCCTGCTGGAGAACTTCAACTGCGCC
CTGCAGGTCTCCGGCGCCCAACCCGCTGAGCTCTTCCGTCTTTTGCGCGA
AGAGAAATGCTAGACGGGATCGGTCGTAAAGTCGGAACAATGAACAGGAC
CATCTTTTGTTCGTCAAAGTCATCCTTTTGTCTTCGATGAAAATACAACC
CTACGAATTTATGAGACAAAAAAAAAAAAAAAA

RE44854.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
m1-RA 1050 m1-RA 111..776 3..668 3330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21838074..21838438 303..667 1795 99.5 Plus
chr3R 27901430 chr3R 21837712..21838012 3..303 1505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26015088..26015453 303..668 1830 100 Plus
3R 32079331 3R 26014726..26015026 3..303 1505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25755919..25756284 303..668 1830 100 Plus
3R 31820162 3R 25755557..25755857 3..303 1505 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:52:23 has no hits.

RE44854.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:53:04 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21837711..21838012 1..303 99 -> Plus
chr3R 21838075..21838438 304..667 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:55 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 1..471 93..563 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:07 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 1..471 93..563 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:55 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz-m1-RA 1..471 93..563 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:25 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 1..471 93..563 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:53 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz-m1-RA 1..471 93..563 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:31 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 2..666 3..667 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:06 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 2..667 1..667 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:55 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz-m1-RA 2..667 1..667 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:26 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
m1-RA 2..666 3..667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:53 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz-m1-RA 5..670 1..667 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:53:04 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26014725..26015026 1..303 99 -> Plus
3R 26015089..26015452 304..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:53:04 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26014725..26015026 1..303 99 -> Plus
3R 26015089..26015452 304..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:53:04 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26014725..26015026 1..303 99 -> Plus
3R 26015089..26015452 304..667 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:55 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21840447..21840748 1..303 99 -> Plus
arm_3R 21840811..21841174 304..667 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:18 Download gff for RE44854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25755556..25755857 1..303 99 -> Plus
3R 25755920..25756283 304..667 100   Plus

RE44854.pep Sequence

Translation from 92 to 562

> RE44854.pep
MMSQTLTLCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKE
FASTCNLLSHNCRRERNSVQAYAATDAAWCSSEFVENLHEKLGNFKLEVK
ECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRL
LREEKC*

RE44854.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16798-PA 156 GF16798-PA 1..156 1..156 717 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11453-PA 156 GG11453-PA 1..156 1..156 801 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19454-PA 166 GH19454-PA 1..156 1..156 435 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Kaz-m1-PB 156 CG8342-PB 1..156 1..156 850 100 Plus
Kaz-m1-PA 156 CG8342-PA 1..156 1..156 850 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24689-PA 156 GI24689-PA 1..156 1..156 478 58 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21818-PA 156 GL21818-PA 1..156 1..156 629 72.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21004-PA 156 GA21004-PA 1..156 1..156 630 73.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10296-PA 156 GM10296-PA 1..156 1..156 817 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\m1-PA 156 GD21260-PA 1..156 1..156 820 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23905-PA 156 GJ23905-PA 18..156 17..156 456 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14457-PA 156 GK14457-PA 1..156 1..156 568 66 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\m1-PA 156 GE23646-PA 1..156 1..156 811 97.4 Plus

RE44854.hyp Sequence

Translation from 92 to 562

> RE44854.hyp
MMSQTLTLCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKE
FASTCNLLSHNCRRERNSVQAYAATDAAWCSSEFVENLHEKLGNFKLEVK
ECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRL
LREEKC*

RE44854.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Kaz-m1-PB 156 CG8342-PB 1..156 1..156 850 100 Plus
Kaz-m1-PA 156 CG8342-PA 1..156 1..156 850 100 Plus