BDGP Sequence Production Resources |
Search the DGRC for RE44854
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 448 |
Well: | 54 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Kaz-m1-RA |
Protein status: | RE44854.pep: gold |
Preliminary Size: | 660 |
Sequenced Size: | 683 |
Gene | Date | Evidence |
---|---|---|
CG8342 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8342 | 2002-04-26 | Blastp of sequenced clone |
CG8342 | 2003-01-01 | Sim4 clustering to Release 3 |
m1 | 2008-04-29 | Release 5.5 accounting |
m1 | 2008-08-15 | Release 5.9 accounting |
m1 | 2008-12-18 | 5.12 accounting |
683 bp (683 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113480
> RE44854.complete TGACCAATTGAAATCGATAGCTACTACAGAGAGAACGCATTCGTCTGTAA AAACCCAAAAAGTAAAAACGAAAGTAAAAAAACAACTTCAAAATGATGAG CCAAACTTTGACCCTTTGCTGCCTTGCATTGGTGGCATGTGTATACGGAA ATACAGTGTCCACCAACGATACCGCTTGTCCAACTTTTTGCCCCAGTATC TACAAGCCAGTATGCGGAACTGATGGCCAGAACTTCAAGGAGTTTGCTAG CACCTGCAATCTTTTGTCCCACAACTGTCGCCGCGAAAGGAATAGCGTGC AGGCCTATGCTGCCACCGATGCCGCCTGGTGCAGCTCCGAGTTCGTCGAG AATCTGCACGAGAAGTTGGGCAACTTCAAGCTGGAGGTCAAGGAATGCTT CAAGCCCTGCTCGATGATCTACCAGCCGGTGTGCATTACCAATGGAAAGT ATCGTGCCGAGTTGGCCAACTCCTGCCTGCTGGAGAACTTCAACTGCGCC CTGCAGGTCTCCGGCGCCCAACCCGCTGAGCTCTTCCGTCTTTTGCGCGA AGAGAAATGCTAGACGGGATCGGTCGTAAAGTCGGAACAATGAACAGGAC CATCTTTTGTTCGTCAAAGTCATCCTTTTGTCTTCGATGAAAATACAACC CTACGAATTTATGAGACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
m1-RA | 1050 | m1-RA | 111..776 | 3..668 | 3330 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21837711..21838012 | 1..303 | 99 | -> | Plus |
chr3R | 21838075..21838438 | 304..667 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 1..471 | 93..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 1..471 | 93..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Kaz-m1-RA | 1..471 | 93..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 1..471 | 93..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Kaz-m1-RA | 1..471 | 93..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 2..666 | 3..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 2..667 | 1..667 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Kaz-m1-RA | 2..667 | 1..667 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
m1-RA | 2..666 | 3..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Kaz-m1-RA | 5..670 | 1..667 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26014725..26015026 | 1..303 | 99 | -> | Plus |
3R | 26015089..26015452 | 304..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26014725..26015026 | 1..303 | 99 | -> | Plus |
3R | 26015089..26015452 | 304..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26014725..26015026 | 1..303 | 99 | -> | Plus |
3R | 26015089..26015452 | 304..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21840447..21840748 | 1..303 | 99 | -> | Plus |
arm_3R | 21840811..21841174 | 304..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25755556..25755857 | 1..303 | 99 | -> | Plus |
3R | 25755920..25756283 | 304..667 | 100 | Plus |
Translation from 92 to 562
> RE44854.pep MMSQTLTLCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKE FASTCNLLSHNCRRERNSVQAYAATDAAWCSSEFVENLHEKLGNFKLEVK ECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRL LREEKC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16798-PA | 156 | GF16798-PA | 1..156 | 1..156 | 717 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11453-PA | 156 | GG11453-PA | 1..156 | 1..156 | 801 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19454-PA | 166 | GH19454-PA | 1..156 | 1..156 | 435 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Kaz-m1-PB | 156 | CG8342-PB | 1..156 | 1..156 | 850 | 100 | Plus |
Kaz-m1-PA | 156 | CG8342-PA | 1..156 | 1..156 | 850 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24689-PA | 156 | GI24689-PA | 1..156 | 1..156 | 478 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21818-PA | 156 | GL21818-PA | 1..156 | 1..156 | 629 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21004-PA | 156 | GA21004-PA | 1..156 | 1..156 | 630 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10296-PA | 156 | GM10296-PA | 1..156 | 1..156 | 817 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\m1-PA | 156 | GD21260-PA | 1..156 | 1..156 | 820 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23905-PA | 156 | GJ23905-PA | 18..156 | 17..156 | 456 | 57.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14457-PA | 156 | GK14457-PA | 1..156 | 1..156 | 568 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\m1-PA | 156 | GE23646-PA | 1..156 | 1..156 | 811 | 97.4 | Plus |
Translation from 92 to 562
> RE44854.hyp MMSQTLTLCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKE FASTCNLLSHNCRRERNSVQAYAATDAAWCSSEFVENLHEKLGNFKLEVK ECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRL LREEKC*