Clone RE44872 Report

Search the DGRC for RE44872

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:448
Well:72
Vector:pFlc-1
Associated Gene/TranscriptImpL1-RC
Protein status:RE44872.pep: gold
Sequenced Size:1173

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10717 2004-03-31 Blastp of sequenced clone
ImpL1 2008-04-29 Release 5.5 accounting
ImpL1 2008-08-15 Release 5.9 accounting
ImpL1 2008-12-18 5.12 accounting

Clone Sequence Records

RE44872.complete Sequence

1173 bp (1173 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012464

> RE44872.complete
ATCAGTTGTTGTGGAGTCGAGCAGCTGACCAGATCAACATGAGGCCATAC
CAAGTAGTTTGCATCGTAGTAGCAGCTCTGCTGCTTTTGGAGGCGATTCC
CGCGGATGCAAAGCGGCGCAAGCACAAGGGCTCCGATCATCACTATGAAA
AGTCTGATCCCCACAAGACCAAGACAAAGACCAAGTGGTCTAGCTCCACG
GATTTGGCTGGAAACACTCCAATTTCCACCGAAGAGCACGGCTACTATGT
AAAGCGCACCTTTGCGGCTCCCGGTGAGATTGGAGCCGCACAGAAGCGTC
TAAGTCCCCCCTATTTGGCCATTCCCATCGCCTGGTTCAGCTGTGAGTCG
GGCCAGAAGAATTGCCAGTCTTCCAATTCCGCGGCTATCAACAGTGCCGC
GCAGTCCTTGAGCGAGGGCTATCTGTGCGACGATGATTGCGATGAACTGT
ACGAGCCCATCTGCGGCAGGACCACCTCAGAGGTGGCCGTTTTCTACAAC
AAGTGCAAGTTGGGTGTAGCCAAGTGCCGATCCCACGGTCTTTGGACGGA
CTTCGCCTATGCCGAGTGCCAGGCGAAATATCCGCAGGAAACTGCCTATG
CCGACAAGAAGTTCCGGTCATCGCCTTATTTCCGGGATGCGGCCATCGTG
GAGCAATTGAAGCTGGAGGAGGAGAAGCGTAAGCAGGAGGAGGAACAACA
CAAGCTGGAGAAGGAGCAAAAGAAGAAGGAGAAGGCTGAGAAAAATAAGA
ACGAGAAGGACAGCAGCGAAAGCAGCGAGGAGAAGGATGACCAAAAGGAA
AACAAGCAGAAGGATCCCCTTTCCCTAATGCCACAGAAGAAAGTGGAATC
CACCCAGAAGCCAGTGCCAGTTCCTATTCAAGTAGCAGTTCCAAAACCAG
TTTCAGTTTTGGAGCCTGCAAAGACGACCGAGGACATCGCTATGCCGCCT
ATGCCACTGAAGGACACTCCCACGCCCAAACCTCTGGAGATCGCGCCCCT
TCACCAGCAGACCCAACCCAAGGGCAAGGACATTGATAGGCTCAAGTACC
AAGTAGCTTAGAAAGCAATGGCTACACAAATCTCACCTAATTATAGTATT
TATTTAATTTATTACAACAAATAAAATTCTAAACAACGATAATCATCTAT
ATTTGAGAAAAAAAAAAAAAAAA

RE44872.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RC 1274 ImpL1-RC 14..1178 1..1165 5795 99.8 Plus
ImpL1-RA 1431 ImpL1-RA 168..1335 1..1165 5740 99.5 Plus
ImpL1-RB 1232 ImpL1-RB 143..1231 68..1156 5445 100 Plus
ImpL1-RB 1232 ImpL1-RB 1..66 4..69 330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13373139..13374227 68..1156 5445 100 Plus
chr3L 24539361 chr3L 13372994..13373062 1..69 345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13382912..13384009 68..1165 5460 99.8 Plus
3L 28110227 3L 13382767..13382835 1..69 345 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13376012..13377109 68..1165 5460 99.8 Plus
3L 28103327 3L 13375867..13375935 1..69 345 100 Plus
Blast to na_te.dros performed 2019-03-15 22:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 703..782 1154..1072 118 66.7 Minus
TART-C 11124 TART-C TARTC 11124bp 8767..8891 660..778 117 56.8 Plus
micropia 5461 micropia DMDM11 5461bp 3942..3996 544..492 116 72.7 Minus

RE44872.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:45:09 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13372994..13373062 1..69 100 -> Plus
chr3L 13373141..13373735 70..664 100 == Plus
chr3L 13373886..13374227 815..1157 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:56 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1026 39..1061 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:57 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 1..1023 39..1061 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:38 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 1..1023 39..1061 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:45 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1026 39..1061 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:34:10 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 1..1023 39..1061 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:49 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1159 1..1157 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:57 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 11..1165 1..1155 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:38 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 3..1157 1..1155 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:45 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1159 1..1157 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:34:10 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RC 3..1157 1..1155 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:45:09 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382767..13382835 1..69 100 -> Plus
3L 13382914..13384000 70..1157 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:45:09 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382767..13382835 1..69 100 -> Plus
3L 13382914..13384000 70..1157 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:45:09 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382767..13382835 1..69 100 -> Plus
3L 13382914..13384000 70..1157 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:38 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13375867..13375935 1..69 100 -> Plus
arm_3L 13376014..13377100 70..1157 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:10 Download gff for RE44872.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13376014..13377100 70..1157 99   Plus
3L 13375867..13375935 1..69 100 -> Plus

RE44872.hyp Sequence

Translation from 2 to 1060

> RE44872.hyp
QLLWSRAADQINMRPYQVVCIVVAALLLLEAIPADAKRRKHKGSDHHYEK
SDPHKTKTKTKWSSSTDLAGNTPISTEEHGYYVKRTFAAPGEIGAAQKRL
SPPYLAIPIAWFSCESGQKNCQSSNSAAINSAAQSLSEGYLCDDDCDELY
EPICGRTTSEVAVFYNKCKLGVAKCRSHGLWTDFAYAECQAKYPQETAYA
DKKFRSSPYFRDAAIVEQLKLEEEKRKQEEEQHKLEKEQKKKEKAEKNKN
EKDSSESSEEKDDQKENKQKDPLSLMPQKKVESTQKPVPVPIQVAVPKPV
SVLEPAKTTEDIAMPPMPLKDTPTPKPLEIAPLHQQTQPKGKDIDRLKYQ
VA*

RE44872.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PC 340 CG10717-PC 1..340 13..352 1793 100 Plus
ImpL1-PA 341 CG10717-PA 1..341 13..352 1781 99.7 Plus
ImpL1-PB 366 CG10717-PB 1..366 13..352 1756 92.9 Plus

RE44872.pep Sequence

Translation from 38 to 1060

> RE44872.pep
MRPYQVVCIVVAALLLLEAIPADAKRRKHKGSDHHYEKSDPHKTKTKTKW
SSSTDLAGNTPISTEEHGYYVKRTFAAPGEIGAAQKRLSPPYLAIPIAWF
SCESGQKNCQSSNSAAINSAAQSLSEGYLCDDDCDELYEPICGRTTSEVA
VFYNKCKLGVAKCRSHGLWTDFAYAECQAKYPQETAYADKKFRSSPYFRD
AAIVEQLKLEEEKRKQEEEQHKLEKEQKKKEKAEKNKNEKDSSESSEEKD
DQKENKQKDPLSLMPQKKVESTQKPVPVPIQVAVPKPVSVLEPAKTTEDI
AMPPMPLKDTPTPKPLEIAPLHQQTQPKGKDIDRLKYQVA*

RE44872.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24041-PA 356 GF24041-PA 1..356 1..340 891 65.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15638-PA 343 GG15638-PA 1..343 1..340 1345 86.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17161-PA 320 GH17161-PA 1..278 1..313 766 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PC 340 CG10717-PC 1..340 1..340 1793 100 Plus
ImpL1-PA 341 CG10717-PA 1..341 1..340 1781 99.7 Plus
ImpL1-PB 366 CG10717-PB 1..366 1..340 1756 92.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11776-PA 362 GI11776-PA 1..292 1..310 696 52.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15712-PA 323 GL15712-PA 44..323 42..340 848 59.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10517-PA 323 GA10517-PA 1..323 1..340 883 60.6 Plus
Dpse\GA29257-PA 304 GA29257-PA 1..197 1..208 658 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25416-PA 342 GM25416-PA 1..342 1..340 1383 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14446-PA 342 GD14446-PA 1..342 1..340 1377 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13478-PA 333 GJ13478-PA 1..277 1..308 756 54.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17441-PA 324 GK17441-PA 1..277 1..319 667 50.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21966-PA 348 GE21966-PA 1..348 1..340 1409 88.8 Plus