Clone RE44908 Report

Search the DGRC for RE44908

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:449
Well:8
Vector:pFlc-1
Associated Gene/TranscriptRrp40-RA
Protein status:RE44908.pep: gold
Sequenced Size:857

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31938 2003-01-01 Sim4 clustering to Release 3
CG31938 2008-04-29 Release 5.5 accounting
CG31938 2008-08-15 Release 5.9 accounting
CG31938 2008-12-18 5.12 accounting

Clone Sequence Records

RE44908.complete Sequence

857 bp (857 high quality bases) assembled on 2005-08-04

GenBank Submission: BT023807

> RE44908.complete
GCGGTGTTGGAAAGTCCTCGACTTGACCATATGTTTTGAAAGACACACGC
GGATTTTTTGTTTGGAGTTTTCAAATCGTAAAAGCAACATTAAAATGAGC
GCGACCAGCACAATAGTTATGCCCGGTGAGCGAATTGCGGCCATTGAGGA
GCTGGCCAAGAGCAAGCGGGTGATACTCGGACCGGGACTGCGGCGTCTGG
ATGACACGGTGGTGGCTAGCAAGGCGGGCCCACTTCGACACAAGGAACCC
GGCACCTTCTGGGTGGACAACTACCAGAGAAGGTACATCCCGGCACGCGG
GGATCTCATTCTGGGCATTGTGCGAGCCAAGGCGGGCGATCTGTACCGCG
TGGACATCGGAGCAACGGACACAGCCTCCATATCGTATCTCGCCTTTGAG
GCGGCCAGCAAGAAGAATCGCCCGGATCTGATCCCCGGTGATCTGATTTA
CGCGAGAGTCCTGAATGCAAGCGCGGACATTGAACCGGAGCTGGTCTGCG
TCAACTCGGTGGGCAAAAGTGGCAAACTGGGCGTCCTCACCGATGGATTC
TTCTTCAAGTGCAGCCTGAATCTGGGAAGGATGCTGCTGCGGGAAAACTG
CCCTGTTCTCGCCGCTCTTACCCGGGAACTGCCCTACGAGATCGCTGTGG
GAGTCAACGGCAGGATATGGTTGAAGGCCCATTCCCTGAAAGAAACCGTG
GCCCTCGCCAATGCCATTTCAGCGCTGGAGCAATCGGGATGTGCGGAAAT
CGACAAAATATGTGGCAATCTCGGAGACTTCCTGCAGGCCTAGGATTAGT
TCTTAGTTTACTTACTTTTATATAAAAAGAAATGGTTAGCCAAAAAAAAA
AAAAAAA

RE44908.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp40-RA 841 Rrp40-RA 4..841 4..841 4190 100 Plus
Eno-RE 2597 Eno-RE 1..304 844..541 1520 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1728556..1729393 4..841 4115 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1728738..1729578 4..844 4205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1728738..1729578 4..844 4205 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:03:49 has no hits.

RE44908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:04:52 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1728553..1729393 1..841 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:17:59 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
CG31938-RA 1..699 95..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:32 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 1..699 95..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:19:00 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 1..699 95..793 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:26:30 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
CG31938-RA 1..699 95..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:46:22 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 1..699 95..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:18 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
CG31938-RA 1..793 1..793 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:32 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 1..841 1..841 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:19:00 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 4..844 1..841 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:26:30 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
CG31938-RA 1..793 1..793 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:46:22 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp40-RA 4..844 1..841 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:52 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1728735..1729575 1..841 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:52 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1728735..1729575 1..841 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:04:52 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1728735..1729575 1..841 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:19:00 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1728735..1729575 1..841 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:59:30 Download gff for RE44908.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1728735..1729575 1..841 99   Plus

RE44908.hyp Sequence

Translation from 0 to 792

> RE44908.hyp
QCWKVLDLTICFERHTRIFCLEFSNRKSNIKMSATSTIVMPGERIAAIEE
LAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARG
DLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIY
ARVLNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENC
PVLAALTRELPYEIAVGVNGRIWLKAHSLKETVALANAISALEQSGCAEI
DKICGNLGDFLQA*

RE44908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp40-PB 232 CG31938-PB 1..232 32..263 1176 100 Plus
Rrp40-PA 232 CG31938-PA 1..232 32..263 1176 100 Plus

RE44908.pep Sequence

Translation from 94 to 792

> RE44908.pep
MSATSTIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHK
EPGTFWVDNYQRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLA
FEAASKKNRPDLIPGDLIYARVLNASADIEPELVCVNSVGKSGKLGVLTD
GFFFKCSLNLGRMLLRENCPVLAALTRELPYEIAVGVNGRIWLKAHSLKE
TVALANAISALEQSGCAEIDKICGNLGDFLQA*

RE44908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14006-PA 232 GF14006-PA 1..232 1..232 1064 84.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24804-PA 232 GG24804-PA 1..231 1..231 1146 93.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25200-PA 232 GH25200-PA 1..232 1..232 1015 79.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp40-PB 232 CG31938-PB 1..232 1..232 1176 100 Plus
Rrp40-PA 232 CG31938-PA 1..232 1..232 1176 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17269-PA 232 GI17269-PA 1..231 1..231 997 77.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19652-PA 232 GL19652-PA 1..232 1..232 1022 80.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16580-PA 232 GA16580-PA 1..232 1..232 1018 80.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16829-PA 232 GM16829-PA 1..231 1..231 1177 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23107-PA 232 GD23107-PA 1..231 1..231 1172 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22758-PA 232 GJ22758-PA 1..232 1..232 1011 79.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20196-PA 235 GK20196-PA 6..234 3..231 1031 81.7 Plus
Dwil\GK18349-PA 235 GK18349-PA 6..234 3..231 1026 81.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17692-PA 232 GE17692-PA 1..231 1..231 1166 96.1 Plus