Clone RE45077 Report

Search the DGRC for RE45077

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:450
Well:77
Vector:pFlc-1
Associated Gene/TranscriptCG2772-RA
Protein status:RE45077.pep: gold
Preliminary Size:1269
Sequenced Size:1343

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2772 2002-01-01 Sim4 clustering to Release 2
CG2772 2002-06-07 Blastp of sequenced clone
CG2772 2003-01-01 Sim4 clustering to Release 3
CG2772 2008-04-29 Release 5.5 accounting
CG2772 2008-08-15 Release 5.9 accounting
CG2772 2008-12-18 5.12 accounting

Clone Sequence Records

RE45077.complete Sequence

1343 bp (1343 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119647

> RE45077.complete
TGTCGCACGACCGTCCTCGCAGCCAAAAGTTCAGCCAGAAATGCTGGCCA
AAGTGCTAACTATCTTGGCCATCGTGGCTTCAGCAGGAGCTGCTGACGAC
TTTGATCCTTTCATAGATATACCCTTCAAACGGCTCAAGACTTCGGCGGA
GCGCATTGCGGAGCACGGCTACCCGGCCGAATCGCATTTTGTTGAGACCC
CGGACGGCTATGTGCTGAATGTGTTCCGCATTCCCCACTCCCCCAAGCTG
AATAGCAATGGCAACGAGGGGGAGTCGGAGGCATCGCGCCCGGTGGTCCT
CATCATGCACGGGCTGTTCAGCTGCTCGGATTGCTTCCTGCTCAATGGGC
CGGAGGATGCGCTGCCGTACAACTACGCAGATGCCGGCTACGATGTCTGG
CTAGGCAACGCCCGTGGCAACATCTATTCGAGAAACAACACCCGGCTGAA
CGTGAAGCATCCGTACTTCTGGAAGTTTAGCTGGCACGAGATTGGCTCCA
TCGATTTGCCCGCCACGATTGACTACATCCTGGCTGAGACGGGTCAACAG
TCGCTGCACTACGTCGGCCATTCCCAGGGATGCACTTCCTTCTTCGTGAT
GGGTTCCTACCGGCCGGAGTACAATGCCAAGATCAAGACGGCGCACATGC
TCGCACCGCCCGTCTACATGGGCAACTCCACAGAGGGACTCATTGTGAGC
ACAGCTCCGCTGTTTGGTCACCATGGCATTGGCTCCACGCTGCTGGAAAA
CCAGGTTTTGCTGCCCCAGAACGCGTTCATCCAGCGAGTACTGGACACCA
CATGCAGCAATCAGCCGATCATGCTCAGCTACTGCAAAACCTTGGCCATC
CTCTGGGGAGGTCCCGAAATCGGCAACCTTAACCAGACTCTGCTCCCGCA
AATTGCCGAAACCCATCCCGCTGGAGTCTCCTCAAACCAGGCCATTCACT
ACATTCAGTCCTACGCCTCCAACGATTTCCGTTTGTACGATTGGGGCAGC
AAGAGAAACCTGGAATACTACGGCGTGTCAGAGCCTCCGGCATATGATCT
CACCAAGATCACCTCCGAGCTGTACTTATACTATGGCTTGGCTGATGGAT
CGGCCAATAAGCAGGACATCTCCCGTCTGCCCGATCTTCTGCCCAATTTG
GCACTGCTTCACGAGGTGCCCGATTCCACATGGGGTCACTTGGACTTTAT
CTTCGCCACGGAGGTCAAGAGAGTGATTAACGATTTGGTTTTGGATTACA
GTAAAGCCTACGATGCGCGAGAAACTAACAATGAGATTTGAGATGATAAG
ATTTTGAGCAAAATAAATGTTTTTTCCAAATTAAAAAAAAAAA

RE45077.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG2772-RA 1439 CG2772-RA 97..1429 2..1334 6665 100 Plus
CG5932-RA 1517 CG5932-RA 475..528 481..534 150 85.1 Plus
CG5932-RA 1517 CG5932-RA 209..264 197..252 145 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3445931..3446672 145..886 3605 99.1 Plus
chr2L 23010047 chr2L 3446724..3447172 884..1332 2230 99.8 Plus
chr2L 23010047 chr2L 3445582..3445726 2..146 725 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3446348..3447089 145..886 3710 100 Plus
2L 23513712 2L 3447141..3447591 884..1334 2255 100 Plus
2L 23513712 2L 3445999..3446143 2..146 725 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3446348..3447089 145..886 3710 100 Plus
2L 23513712 2L 3447141..3447591 884..1334 2255 100 Plus
2L 23513712 2L 3445999..3446143 2..146 725 100 Plus
3L 28103327 3L 20454217..20454270 481..534 150 85.1 Plus
3L 28103327 3L 20453951..20454006 197..252 145 83.9 Plus
Blast to na_te.dros performed on 2019-03-16 12:23:53 has no hits.

RE45077.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:24:39 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3445580..3445725 1..145 99 -> Plus
chr2L 3445932..3446672 146..886 99 -> Plus
chr2L 3446727..3447172 887..1332 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:07 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1251 41..1291 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:30 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1251 41..1291 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:19:15 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1251 41..1291 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:19:47 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1251 41..1291 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:06 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1251 41..1291 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:58:55 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1333 1..1332 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:30 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1333 1..1332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:19:15 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 6..1338 1..1332 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:19:47 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 1..1333 1..1332 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:06 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
CG2772-RA 6..1338 1..1332 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:39 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3445997..3446142 1..145 99 -> Plus
2L 3446349..3447089 146..886 100 -> Plus
2L 3447144..3447589 887..1332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:39 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3445997..3446142 1..145 99 -> Plus
2L 3446349..3447089 146..886 100 -> Plus
2L 3447144..3447589 887..1332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:39 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3445997..3446142 1..145 99 -> Plus
2L 3446349..3447089 146..886 100 -> Plus
2L 3447144..3447589 887..1332 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:19:15 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3445997..3446142 1..145 99 -> Plus
arm_2L 3446349..3447089 146..886 100 -> Plus
arm_2L 3447144..3447589 887..1332 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:24 Download gff for RE45077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3446349..3447089 146..886 100 -> Plus
2L 3447144..3447589 887..1332 100   Plus
2L 3445997..3446142 1..145 99 -> Plus

RE45077.hyp Sequence

Translation from 0 to 1290

> RE45077.hyp
VARPSSQPKVQPEMLAKVLTILAIVASAGAADDFDPFIDIPFKRLKTSAE
RIAEHGYPAESHFVETPDGYVLNVFRIPHSPKLNSNGNEGESEASRPVVL
IMHGLFSCSDCFLLNGPEDALPYNYADAGYDVWLGNARGNIYSRNNTRLN
VKHPYFWKFSWHEIGSIDLPATIDYILAETGQQSLHYVGHSQGCTSFFVM
GSYRPEYNAKIKTAHMLAPPVYMGNSTEGLIVSTAPLFGHHGIGSTLLEN
QVLLPQNAFIQRVLDTTCSNQPIMLSYCKTLAILWGGPEIGNLNQTLLPQ
IAETHPAGVSSNQAIHYIQSYASNDFRLYDWGSKRNLEYYGVSEPPAYDL
TKITSELYLYYGLADGSANKQDISRLPDLLPNLALLHEVPDSTWGHLDFI
FATEVKRVINDLVLDYSKAYDARETNNEI*

RE45077.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG2772-PA 416 CG2772-PA 1..416 14..429 2215 100 Plus
CG31089-PA 421 CG31089-PA 10..417 18..423 917 45.2 Plus
mag-PA 399 CG5932-PA 23..399 39..423 894 46.4 Plus
CG31091-PC 424 CG31091-PC 59..424 52..423 815 42.7 Plus
CG31091-PB 424 CG31091-PB 59..424 52..423 815 42.7 Plus

RE45077.pep Sequence

Translation from 40 to 1290

> RE45077.pep
MLAKVLTILAIVASAGAADDFDPFIDIPFKRLKTSAERIAEHGYPAESHF
VETPDGYVLNVFRIPHSPKLNSNGNEGESEASRPVVLIMHGLFSCSDCFL
LNGPEDALPYNYADAGYDVWLGNARGNIYSRNNTRLNVKHPYFWKFSWHE
IGSIDLPATIDYILAETGQQSLHYVGHSQGCTSFFVMGSYRPEYNAKIKT
AHMLAPPVYMGNSTEGLIVSTAPLFGHHGIGSTLLENQVLLPQNAFIQRV
LDTTCSNQPIMLSYCKTLAILWGGPEIGNLNQTLLPQIAETHPAGVSSNQ
AIHYIQSYASNDFRLYDWGSKRNLEYYGVSEPPAYDLTKITSELYLYYGL
ADGSANKQDISRLPDLLPNLALLHEVPDSTWGHLDFIFATEVKRVINDLV
LDYSKAYDARETNNEI*

RE45077.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14186-PA 362 GF14186-PA 23..358 22..410 1483 72.5 Plus
Dana\GF10345-PA 399 GF10345-PA 23..399 26..410 911 47.2 Plus
Dana\GF16784-PA 423 GF16784-PA 37..419 22..410 865 43.3 Plus
Dana\GF16783-PA 425 GF16783-PA 5..423 2..410 832 40.7 Plus
Dana\GF17389-PA 394 GF17389-PA 23..394 30..408 784 42.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24941-PA 406 GG24941-PA 1..406 1..410 2040 92 Plus
Dere\GG16116-PA 399 GG16116-PA 4..399 5..410 896 45.2 Plus
Dere\GG11437-PA 422 GG11437-PA 36..418 22..410 881 44.3 Plus
Dere\GG11436-PA 428 GG11436-PA 59..424 39..410 821 44.3 Plus
Dere\GG17061-PA 394 GG17061-PA 23..394 30..408 795 42.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10558-PA 402 GH10558-PA 1..400 1..408 1460 64.5 Plus
Dgri\GH10557-PA 404 GH10557-PA 1..402 1..408 1440 63.3 Plus
Dgri\GH10259-PA 537 GH10259-PA 1..267 61..334 1020 65.3 Plus
Dgri\GH23213-PA 422 GH23213-PA 12..411 5..401 930 47.1 Plus
Dgri\GH19444-PA 424 GH19444-PA 12..424 5..416 926 46.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG2772-PA 416 CG2772-PA 1..416 1..416 2215 100 Plus
CG31089-PA 421 CG31089-PA 10..417 5..410 917 45.2 Plus
mag-PA 399 CG5932-PA 23..399 26..410 894 46.4 Plus
CG31091-PC 424 CG31091-PC 59..424 39..410 815 42.7 Plus
CG31091-PB 424 CG31091-PB 59..424 39..410 815 42.7 Plus
Lip3-PA 394 CG8823-PA 30..394 37..408 786 43.8 Plus
CG3635-PB 425 CG3635-PB 49..419 33..408 757 42.3 Plus
CG11608-PB 430 CG11608-PB 47..407 34..408 731 41.4 Plus
CG18530-PA 389 CG18530-PA 20..380 34..408 722 40.9 Plus
CG6753-PB 405 CG6753-PB 35..403 35..410 710 41 Plus
CG8093-PB 398 CG8093-PB 3..393 5..402 700 38 Plus
CG8093-PA 398 CG8093-PA 3..393 5..402 700 38 Plus
CG11600-PB 406 CG11600-PB 47..405 39..411 671 38.9 Plus
CG11598-PB 388 CG11598-PB 12..380 24..408 666 39.4 Plus
Lip4-PB 432 CG6113-PB 47..428 9..408 619 35.2 Plus
Lip4-PA 434 CG6113-PA 47..430 9..408 618 35 Plus
Lip4-PC 448 CG6113-PC 61..444 9..408 618 35 Plus
CG31871-PA 531 CG31871-PA 83..441 39..410 617 35.9 Plus
Lip1-PB 439 CG7279-PB 72..406 39..396 602 37.2 Plus
Lip1-PA 439 CG7279-PA 72..406 39..396 602 37.2 Plus
CG7329-PB 457 CG7329-PB 46..390 39..408 578 37.4 Plus
CG7329-PA 457 CG7329-PA 46..390 39..408 578 37.4 Plus
CG18301-PA 422 CG18301-PA 27..391 21..396 577 34.4 Plus
CG18302-PA 406 CG18302-PA 47..405 39..411 574 35.7 Plus
CG17097-PB 1087 CG17097-PB 725..1078 34..401 567 34.8 Plus
CG11406-PB 396 CG11406-PB 38..390 49..408 521 35.3 Plus
CG31872-PB 1073 CG31872-PB 706..1068 25..402 515 33.1 Plus
CG31872-PA 1073 CG31872-PA 706..1068 25..402 515 33.1 Plus
CG3635-PC 301 CG3635-PC 49..294 33..282 501 42.4 Plus
CG18284-PB 457 CG18284-PB 89..450 25..401 488 31.8 Plus
CG18284-PC 457 CG18284-PC 89..450 25..401 488 31.8 Plus
CG11406-PA 326 CG11406-PA 1..320 89..408 483 35.1 Plus
Lip2-PA 413 CG17116-PA 10..403 6..407 327 25.8 Plus
Lip2-PB 377 CG17116-PB 12..367 47..407 323 26.6 Plus
CG11406-PD 266 CG11406-PD 1..160 89..248 311 42.2 Plus
CG11406-PC 266 CG11406-PC 1..160 89..248 311 42.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16796-PA 408 GI16796-PA 22..408 20..413 1519 70.1 Plus
Dmoj\GI13397-PA 401 GI13397-PA 25..401 29..410 913 47.3 Plus
Dmoj\GI24674-PA 420 GI24674-PA 5..418 1..408 895 43.2 Plus
Dmoj\GI22981-PA 422 GI22981-PA 51..417 31..408 848 47.1 Plus
Dmoj\GI20075-PA 407 GI20075-PA 21..398 28..408 822 43.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18612-PA 410 GL18612-PA 19..408 15..410 1759 80.6 Plus
Dper\GL22025-PA 425 GL22025-PA 23..419 10..408 901 45.9 Plus
Dper\GL21801-PA 422 GL21801-PA 23..421 10..414 881 44.4 Plus
Dper\GL12789-PA 399 GL12789-PA 23..399 26..410 859 45.6 Plus
Dper\GL22024-PA 429 GL22024-PA 30..426 13..410 834 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15458-PA 410 GA15458-PA 5..408 1..410 1784 78.8 Plus
Dpse\GA15999-PA 425 GA15999-PA 23..419 10..408 901 45.9 Plus
Dpse\GA19240-PA 399 GA19240-PA 23..399 26..410 862 45.3 Plus
Dpse\GA16001-PA 429 GA16001-PA 56..426 34..410 839 44.2 Plus
Dpse\GA17576-PA 470 GA17576-PA 93..461 36..408 815 44.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11136-PA 416 GM11136-PA 1..415 1..415 2161 96.6 Plus
Dsec\GM10277-PA 421 GM10277-PA 10..417 5..410 905 44.3 Plus
Dsec\GM25946-PA 394 GM25946-PA 23..394 30..408 801 43 Plus
Dsec\GM10276-PA 424 GM10276-PA 59..424 39..410 798 42.7 Plus
Dsec\GM22294-PA 362 GM22294-PA 37..362 83..410 766 46.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12011-PA 230 GD12011-PA 1..229 187..415 1184 96.5 Plus
Dsim\GD21247-PA 421 GD21247-PA 10..417 5..410 903 44.3 Plus
Dsim\GD14888-PA 399 GD14888-PA 23..399 26..410 879 46.4 Plus
Dsim\GD20506-PA 394 GD20506-PA 23..394 30..408 801 43 Plus
Dsim\GD21246-PA 424 GD21246-PA 59..424 39..410 794 42.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17195-PA 407 GJ17195-PA 19..407 20..414 1531 70.6 Plus
Dvir\GJ23893-PA 424 GJ23893-PA 12..424 1..416 906 44.7 Plus
Dvir\GJ11522-PA 401 GJ11522-PA 7..401 5..410 905 46.4 Plus
Dvir\GJ24675-PA 422 GJ24675-PA 51..420 31..409 841 44.6 Plus
Dvir\GJ13469-PA 405 GJ13469-PA 21..396 28..408 795 43.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15530-PA 410 GK15530-PA 1..405 1..409 1757 78.3 Plus
Dwil\GK12291-PA 406 GK12291-PA 35..406 29..408 907 47.8 Plus
Dwil\GK12870-PA 427 GK12870-PA 37..419 22..408 886 44.4 Plus
Dwil\GK12869-PA 431 GK12869-PA 14..427 5..408 877 44 Plus
Dwil\GK12867-PA 424 GK12867-PA 39..421 22..410 870 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18232-PA 410 GE18232-PA 1..410 1..416 2033 90.4 Plus
Dyak\GE19683-PA 399 GE19683-PA 23..399 26..410 898 47.7 Plus
Dyak\GE23632-PA 421 GE23632-PA 35..408 22..401 876 44.8 Plus
Dyak\GE23631-PA 424 GE23631-PA 59..424 39..410 813 42.9 Plus
Dyak\GE24449-PA 394 GE24449-PA 23..394 30..408 799 43 Plus