Clone RE45155 Report

Search the DGRC for RE45155

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:451
Well:55
Vector:pFlc-1
Associated Gene/TranscriptCG7787-RA
Protein status:RE45155.pep: gold
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7787 2002-01-01 Sim4 clustering to Release 2
CG7787 2002-06-10 Blastp of sequenced clone
CG7787 2003-01-01 Sim4 clustering to Release 3
CG7787 2008-04-29 Release 5.5 accounting
CG7787 2008-08-15 Release 5.9 accounting
CG7787 2008-12-18 5.12 accounting

Clone Sequence Records

RE45155.complete Sequence

885 bp (885 high quality bases) assembled on 2002-06-10

GenBank Submission: BT001655

> RE45155.complete
TGGGGTATCAACTGATTACATTTTACGCATTTGTTGCAAAATTGAGATAA
TTCCACAAAAAAATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGA
TGGGAAAAACAAATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGC
TGAAAGCACAAGAGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTG
ATGACGCAGAAGCAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACT
GAAAGACTTCTGGCTGGTCAAGGACATGATGACATTCGAGAACATCGGGT
TCTCCAACACGGTGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAG
CGAGGACCTGTGGGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGC
CCTCAAGAGGGTGGTGCACAAGGACACCTAGCTGCAGCGATGCCAAACAC
GTGTGTCCAGTCTCTTGCAATCCATTTTATCATGCCACTTATCCGCTAAT
CTTTAATGTATCAGTTTTTCATGCCACGGAATAGAAGCGATTTTCATTTG
ATTTAGTTAGGGTGAAGTAATTGAGTATTTCCTTGAACATGCACTATTTG
TACACTACCATCCTCTAGTTATCAGAAGTATCTATGCTTTTAGTGAAGAT
TCGCTGAACGAATTCGCTGAAAATCCGTGAAATCGAAGGCCTAGTTTGTC
GAGTTTAGATTTAAGCGAAATAAAACGTTTTAACGTGCCTGGTTAGCAAA
TGATTGTGCAAGCATTTTTAAATTAGTAATTATTTAGTTATTTGTTAAAA
CTTTCGTTTTAAAATCTCAGAAAACTTAGAAAACACCCTGGTCATTAAAA
ACATCGCTCTTTTGTATTCAAAAAAAAAAAAAAAA

RE45155.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7787-RA 1006 CG7787-RA 62..929 3..870 4340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8319530..8320213 184..869 3180 98.3 Plus
chr2L 23010047 chr2L 8319279..8319463 3..187 850 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8320600..8321286 184..870 3435 100 Plus
2L 23513712 2L 8320349..8320533 3..187 925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8320600..8321286 184..870 3435 100 Plus
2L 23513712 2L 8320349..8320533 3..187 925 100 Plus
Blast to na_te.dros performed 2019-03-15 20:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2371..2438 756..823 133 66.2 Plus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5..78 812..740 124 64.9 Minus

RE45155.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:20:10 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8319277..8319461 1..185 96 -> Plus
chr2L 8319532..8320213 186..869 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:10 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 63..431 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:02 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 63..431 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:11:06 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 63..431 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:29 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 63..431 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:59 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 63..431 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:54:13 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 24..892 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:02 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 24..892 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:06 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 20..888 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:29 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 24..892 1..869 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:59 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 20..888 1..869 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:10 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8320347..8320531 1..185 99 -> Plus
2L 8320602..8321285 186..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:10 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8320347..8320531 1..185 99 -> Plus
2L 8320602..8321285 186..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:10 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8320347..8320531 1..185 99 -> Plus
2L 8320602..8321285 186..869 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:06 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8320347..8320531 1..185 99 -> Plus
arm_2L 8320602..8321285 186..869 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:48 Download gff for RE45155.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8320602..8321285 186..869 100   Plus
2L 8320347..8320531 1..185 99 -> Plus

RE45155.pep Sequence

Translation from 62 to 430

> RE45155.pep
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT*

RE45155.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14634-PA 122 GF14634-PA 1..122 1..122 554 80.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10534-PA 122 GG10534-PA 1..122 1..122 628 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11590-PA 122 GH11590-PA 1..122 1..122 506 73 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
strat-PA 122 CG7787-PA 1..122 1..122 659 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17159-PA 94 GI17159-PA 1..94 29..122 393 74.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19612-PA 121 GL19612-PA 1..121 1..121 564 81.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23151-PA 121 GA23151-PA 1..121 1..121 564 81.8 Plus
Dpse\GA20587-PA 121 GA20587-PA 1..121 1..121 564 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16890-PA 122 GM16890-PA 1..122 1..122 645 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23523-PA 122 GD23523-PA 1..121 1..121 643 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17663-PA 122 GJ17663-PA 1..122 1..122 514 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24796-PA 121 GK24796-PA 2..121 3..122 526 74.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18753-PA 122 GE18753-PA 1..122 1..122 637 95.9 Plus

RE45155.hyp Sequence

Translation from 62 to 430

> RE45155.hyp
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT*

RE45155.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG7787-PA 122 CG7787-PA 1..122 1..122 659 100 Plus