Clone RE45222 Report

Search the DGRC for RE45222

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:452
Well:22
Vector:pFlc-1
Associated Gene/Transcriptspz6-RA
Protein status:RE45222.pep: gold
Preliminary Size:1371
Sequenced Size:1661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9196 2002-10-12 Blastp of sequenced clone
CG9196 2003-01-01 Sim4 clustering to Release 3
CG9196 2008-04-29 Release 5.5 accounting
CG9196 2008-08-15 Release 5.9 accounting
CG9196 2008-12-18 5.12 accounting

Clone Sequence Records

RE45222.complete Sequence

1661 bp (1661 high quality bases) assembled on 2002-10-12

GenBank Submission: BT001656

> RE45222.complete
TTGAGTTCAGTTGGTGCACTTGACGCGTCTGGTTCTGCTTCCCACCACTG
CGGATTAAGCCAAGCCTGACGAAGGCCAAGTCCAAGAACCTTCTACAAGA
AGCAAACGAGCGGAGATGGATTATCGTCTAGTGCTGAAAATTCTCAGCTT
TCTGCTGCTGGCCCAATTGGGTTTCTCCCAGCCGCAGCAGCAGTCGCCAT
CTGACTACGGTGAGGAGCAGCCTCCGGAGGGTTATTACGCCTTCGTCGAG
TCCCCGAATGCGGTGCCTCCCAAGGTCAGGCCGCCACCTTACACCTTTGT
AAATGCGGAGTGCAAGGACGTGGCCGCCGGCAAGAAGTCTGCCGTGTCCG
TTCACAACATTTGCGGAGATCTAAACAAGGGTCAGATACCCAAGAATCCG
CTGGGACAAAATGTACTCGGGGAGCCCTATCCCTTCGAACTTATTCGCAA
CCAAACGCTGAAGTTCCTTTCGAAAACTTTGCCCGTTCTAAAGGCCGACG
ATACCCTACCCAAGGTCACCCAGATCATTCGAGATGAACCCGTGGAACAG
CTGGACAGCAACAACATCGACAGGCCCTATCCCGCAGGAGGTTCCACTCG
CGTCCGCCGCAGCCTGCCGGAGGGCGTGGAGTCCAACGAGTACAGCTACT
TCGATCCCGCCCTGGACGAGGAGGAGCAACACAAGCAAAGGGATCGGAAT
AACCAGCAGAGAAGGGCCGCCGAGGAGAGGAAGCCAAGGAAATTCTGCGA
TGGCGGTGGAGTATTTTGCACCTTATACAGGGCAATTCAGGGAGACACCG
GAGGAGCAGCCCCTGCCACGCCCACTGCGGAAAGGCGCGAGGAGGTGGGT
CCCATCCGGTACGAGGGTCCTCCCACTCCCTGTCCCGCCAAGGTAGAGTA
CGCTACTCCCGTCTTCGCTAAGAACTACCAAGGCGCCTGGCGTTATGTGG
TCCAGATTCCCTATGAGGGCTACTTCACCCAGACGGTGGAGGTGACGCGT
TGCATTCAGGCACGCTGTCACTACCTGGACGGCGGTTGCTTGTCGTCACC
ACGCTGGGTAAGCCTGTTGGTGGCGGAGATCTTCTACCCCAATGCGGAGG
ACACAGTGCCCACCAGCTCGACCACCACTCAGGCCCCTTCTGTGCAGGAT
TTCCAGGCCTACCAGCAGTACCTGCAGAAGAGGGCAGGCGTGGCTACCGC
CTCCGACGGAACCTCGTCTGGAGCAGCCGGCCCCGCGGCGCAGGTGGACG
CCCACTGCGATGGACACGATGAACTGGGCTGCTTCCAGGTGCGTCTCTAC
TACGACTGGTTCCTCATCCCCGGCTCTTGCAAGTGCTGGCGCCCGGACTA
CTTCGCCAAGTACGTGCGCCGGAAGTCGGTGGCCGAGTTGTGAACACTTC
CTGGACAGGATTTTCGAAGGAAATCCTTAGAATAAGACTAAGTTCTAGCC
TTTAGAGGAACACAACTTTGAGGTGAAAGGCTCATTCTAGTAATCCACCC
GGGTGCCCCACAGCCCTATACGGATCACGCAGAGTTTGCAGTTCGTGCAT
CTACCAGATACAATCTTAACCTAGGCGGTTAGCTCCCTCTTTCGACTGAT
TAAGCCAAGAGCAGTGCATTTCTACTAATAAATACGTTTCTACCTAAAAA
AAAAAAAAAAA

RE45222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
spz6-RA 1816 spz6-RA 104..1747 4..1647 8220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20645522..20646404 763..1645 4400 99.9 Plus
chr2R 21145070 chr2R 20644795..20645121 436..762 1635 100 Plus
chr2R 21145070 chr2R 20644435..20644734 136..435 1500 100 Plus
chr2R 21145070 chr2R 20643321..20643453 4..136 665 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24759584..24760468 763..1647 4425 100 Plus
2R 25286936 2R 24758857..24759183 436..762 1635 100 Plus
2R 25286936 2R 24758497..24758796 136..435 1500 100 Plus
2R 25286936 2R 24757383..24757515 4..136 665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24760783..24761667 763..1647 4425 100 Plus
2R 25260384 2R 24760056..24760382 436..762 1635 100 Plus
2R 25260384 2R 24759696..24759995 136..435 1500 100 Plus
2R 25260384 2R 24758582..24758714 4..136 665 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:37:32 has no hits.

RE45222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:25 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20643318..20643453 1..136 98 -> Plus
chr2R 20644436..20644734 137..435 100 -> Plus
chr2R 20644795..20645121 436..762 100 -> Plus
chr2R 20645522..20646404 763..1645 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:12 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
CG9196-RA 1..1278 116..1393 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:27 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 1..1278 116..1393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:05:14 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 1..1278 116..1393 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:16 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
CG9196-RA 1..1278 116..1393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:40 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 1..1278 116..1393 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:11 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
CG9196-RA 2..1645 2..1645 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:27 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 2..1645 2..1645 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:05:14 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 3..1647 1..1645 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:17 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
CG9196-RA 2..1645 2..1645 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:40 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
spz6-RA 3..1647 1..1645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:25 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24758498..24758796 137..435 100 -> Plus
2R 24757380..24757515 1..136 98 -> Plus
2R 24758857..24759183 436..762 100 -> Plus
2R 24759584..24760466 763..1645 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:25 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24758498..24758796 137..435 100 -> Plus
2R 24757380..24757515 1..136 98 -> Plus
2R 24758857..24759183 436..762 100 -> Plus
2R 24759584..24760466 763..1645 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:25 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24758498..24758796 137..435 100 -> Plus
2R 24757380..24757515 1..136 98 -> Plus
2R 24758857..24759183 436..762 100 -> Plus
2R 24759584..24760466 763..1645 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:05:14 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20644903..20645038 1..136 98 -> Plus
arm_2R 20646021..20646319 137..435 100 -> Plus
arm_2R 20646380..20646706 436..762 100 -> Plus
arm_2R 20647107..20647989 763..1645 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:59 Download gff for RE45222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24759715..24760013 137..435 100 -> Plus
2R 24760074..24760400 436..762 100 -> Plus
2R 24760801..24761683 763..1645 100   Plus
2R 24758597..24758732 1..136 98 -> Plus

RE45222.pep Sequence

Translation from 115 to 1392

> RE45222.pep
MDYRLVLKILSFLLLAQLGFSQPQQQSPSDYGEEQPPEGYYAFVESPNAV
PPKVRPPPYTFVNAECKDVAAGKKSAVSVHNICGDLNKGQIPKNPLGQNV
LGEPYPFELIRNQTLKFLSKTLPVLKADDTLPKVTQIIRDEPVEQLDSNN
IDRPYPAGGSTRVRRSLPEGVESNEYSYFDPALDEEEQHKQRDRNNQQRR
AAEERKPRKFCDGGGVFCTLYRAIQGDTGGAAPATPTAERREEVGPIRYE
GPPTPCPAKVEYATPVFAKNYQGAWRYVVQIPYEGYFTQTVEVTRCIQAR
CHYLDGGCLSSPRWVSLLVAEIFYPNAEDTVPTSSTTTQAPSVQDFQAYQ
QYLQKRAGVATASDGTSSGAAGPAAQVDAHCDGHDELGCFQVRLYYDWFL
IPGSCKCWRPDYFAKYVRRKSVAEL*

RE45222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13569-PA 421 GF13569-PA 1..421 1..425 2005 91.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23001-PA 426 GG23001-PA 1..426 1..425 2202 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20354-PA 429 GH20354-PA 1..429 1..425 1847 85.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
spz6-PA 425 CG9196-PA 1..425 1..425 2286 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20023-PA 420 GI20023-PA 1..420 1..425 1785 86.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16770-PA 434 GL16770-PA 1..434 1..425 1925 89.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21605-PA 432 GA21605-PA 1..432 1..425 1927 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11895-PA 425 GM11895-PA 1..425 1..425 2239 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11893-PA 425 GD11893-PA 1..425 1..425 2242 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21271-PA 424 GJ21271-PA 1..424 1..425 1828 86.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21666-PA 434 GK21666-PA 1..434 1..425 1803 86.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14438-PA 425 GE14438-PA 1..425 1..425 2226 97.6 Plus

RE45222.hyp Sequence

Translation from 115 to 1392

> RE45222.hyp
MDYRLVLKILSFLLLAQLGFSQPQQQSPSDYGEEQPPEGYYAFVESPNAV
PPKVRPPPYTFVNAECKDVAAGKKSAVSVHNICGDLNKGQIPKNPLGQNV
LGEPYPFELIRNQTLKFLSKTLPVLKADDTLPKVTQIIRDEPVEQLDSNN
IDRPYPAGGSTRVRRSLPEGVESNEYSYFDPALDEEEQHKQRDRNNQQRR
AAEERKPRKFCDGGGVFCTLYRAIQGDTGGAAPATPTAERREEVGPIRYE
GPPTPCPAKVEYATPVFAKNYQGAWRYVVQIPYEGYFTQTVEVTRCIQAR
CHYLDGGCLSSPRWVSLLVAEIFYPNAEDTVPTSSTTTQAPSVQDFQAYQ
QYLQKRAGVATASDGTSSGAAGPAAQVDAHCDGHDELGCFQVRLYYDWFL
IPGSCKCWRPDYFAKYVRRKSVAEL*

RE45222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
spz6-PA 425 CG9196-PA 1..425 1..425 2286 100 Plus