Clone RE45235 Report

Search the DGRC for RE45235

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:452
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCOQ7-RA
Protein status:RE45235.pep: gold
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14437 2002-01-01 Sim4 clustering to Release 2
COQ7 2008-04-29 Release 5.5 accounting
COQ7 2008-04-29 Picked prior to 5.5
COQ7 2008-08-15 Release 5.9 accounting
COQ7 2008-12-18 5.12 accounting

Clone Sequence Records

RE45235.complete Sequence

903 bp assembled on 2007-07-16

GenBank Submission: BT031015

> RE45235.complete
ATCCCTGGATTGGATTGCGCAAAAATAAACAGAACGCAAATTGTTTTTGT
GCTCGGCAATTCGGCGAATTGCACTTTACCTAATAATTTATTTATTCAAC
ACAATACATCTCGTGGAAAGCTGCAAATTAGCAATGAATGGAATGCTGAG
AAGAGGTCTTAGCCGGCCCGAGCCACGCCTGCTCTCCAAGCGCTATCTAA
GCTCAGCAACTGGAGGAGGATCAGCAGGCACGACCGAAGGAGGCAGCTCT
GAAACCACCCCGCTGCGTCCACGTCCAAATGCGCTCACAGATGAGATTAT
ACGCGTCGATCATGCCGGCGAATTGGGAGCAGATCGCATTTACGCCGGGC
AAATGGCCATTCTGGGCAACGGACCGCTGGGCAAGACCATCGGACACATG
TGGGAGCAGGAGAAAGAGCATCGTAAACAGTTCGAGCAGCTCATTCAACA
GCACCGCGTGCGTCCAACGATCATGACGCCAATTTGGAACGTGGCCGGAT
TTGTGCTGGGCGCCGGAACCGCCCTCATGGGCGAAAAGGCAGCCATGGCC
TGCACGGTGGCAGTGGAGACGGTGATCGTAGAACACTACAATGACCAGCT
GCGTCAGATAATGGAGGCACCGAACCCGGATAAGGAGCTGTTGGCCACCA
TCACCAAGTTCCGGGACGAGGAGCAGGAGCACCACGACACGGGCATTGAT
CACGGTGCCGAGCAAGCGCCCTTTTACCAGGCCATGACCGAGGTAATCAA
GTTTGGCTGCAAGACGGCTATTGCCATCTCGAAGAAGATCTAGGCTGAAA
CAGTTGGGCCCCCTGTATATATCAAAATCAAATTATCTGTTCCGCTAAGC
TAACCGTGTTAAGCATTAAAGATAGAGCTAAATGTCCAAAAAAAAAAAAA
AAA

RE45235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
COQ7-RA 1117 COQ7-RA 167..1054 1..888 4440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6664358..6664855 138..635 2415 99 Plus
chrX 22417052 chrX 6664916..6665170 633..887 1245 99.2 Plus
chrX 22417052 chrX 6663368..6663504 1..137 685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6772227..6772724 138..635 2490 100 Plus
X 23542271 X 6772785..6773040 633..888 1280 100 Plus
X 23542271 X 6771237..6771373 1..137 685 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6780325..6780822 138..635 2490 100 Plus
X 23527363 X 6780883..6781138 633..888 1280 100 Plus
X 23527363 X 6779335..6779471 1..137 685 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:39:35 has no hits.

RE45235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:40:43 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6663368..6663504 1..137 100 -> Plus
chrX 6664358..6664854 138..634 98 -> Plus
chrX 6664918..6665170 635..887 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:13 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 1..660 134..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:17 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 1..660 134..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:28:41 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 1..660 134..793 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:11:55 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 1..660 134..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:06:59 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 1..660 134..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:01 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 2..888 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:17 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 2..888 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:41 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 13..899 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:11:55 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 2..888 1..887 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:06:59 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
COQ7-RA 13..899 1..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:43 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
X 6771237..6771373 1..137 100 -> Plus
X 6772227..6772723 138..634 100 -> Plus
X 6772787..6773039 635..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:43 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
X 6771237..6771373 1..137 100 -> Plus
X 6772227..6772723 138..634 100 -> Plus
X 6772787..6773039 635..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:43 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
X 6771237..6771373 1..137 100 -> Plus
X 6772227..6772723 138..634 100 -> Plus
X 6772787..6773039 635..887 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:41 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6665270..6665406 1..137 100 -> Plus
arm_X 6666260..6666756 138..634 100 -> Plus
arm_X 6666820..6667072 635..887 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:32 Download gff for RE45235.complete
Subject Subject Range Query Range Percent Splice Strand
X 6780885..6781137 635..887 100   Plus
X 6780325..6780821 138..634 100 -> Plus
X 6779335..6779471 1..137 100 -> Plus

RE45235.hyp Sequence

Translation from 133 to 792

> RE45235.hyp
MNGMLRRGLSRPEPRLLSKRYLSSATGGGSAGTTEGGSSETTPLRPRPNA
LTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQF
EQLIQQHRVRPTIMTPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVE
HYNDQLRQIMEAPNPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYQA
MTEVIKFGCKTAIAISKKI*

RE45235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
COQ7-PA 219 CG14437-PA 1..219 1..219 1140 100 Plus

RE45235.pep Sequence

Translation from 133 to 792

> RE45235.pep
MNGMLRRGLSRPEPRLLSKRYLSSATGGGSAGTTEGGSSETTPLRPRPNA
LTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQF
EQLIQQHRVRPTIMTPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVE
HYNDQLRQIMEAPNPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYQA
MTEVIKFGCKTAIAISKKI*

RE45235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19758-PA 40 GF19758-PA 1..40 180..219 213 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19611-PA 217 GG19611-PA 1..217 4..219 1068 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24447-PA 220 GH24447-PA 50..220 49..219 836 90.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
COQ7-PA 219 CG14437-PA 1..219 1..219 1140 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21648-PA 210 GI21648-PA 20..210 29..219 887 88 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26752-PA 215 GL26752-PA 1..215 1..219 967 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12984-PA 215 GA12984-PA 1..215 1..219 968 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12529-PA 216 GM12529-PA 1..216 4..219 1111 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16815-PA 187 GD16815-PA 1..183 1..183 952 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16885-PA 221 GJ16885-PA 46..221 44..219 887 93.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25105-PA 215 GK25105-PA 36..215 43..219 900 93.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16772-PA 216 GE16772-PA 1..216 4..219 1088 95.4 Plus