Clone RE45276 Report

Search the DGRC for RE45276

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:452
Well:76
Vector:pFlc-1
Associated Gene/TranscriptMpp6-RA
Protein status:RE45276.pep: gold
Preliminary Size:444
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9250 2002-01-01 Sim4 clustering to Release 2
CG9250 2002-04-26 Blastp of sequenced clone
CG9250 2003-01-01 Sim4 clustering to Release 3
Mpp6 2008-04-29 Release 5.5 accounting
Mpp6 2008-08-15 Release 5.9 accounting
Mpp6 2008-12-18 5.12 accounting

Clone Sequence Records

RE45276.complete Sequence

667 bp (667 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113483

> RE45276.complete
CTTCTTTTGAAAAAAATTAAATGTGCCTGATGGTTTCGCCCTAGTTTTTA
AACTCAAAGGACTTCTACTATATTAGATTCAAAAATAAATAAGGAAAATG
CCATCCAAATCAAAGCCGAGACTTTCGCGTGGTGTCCTGGACATGAAGTT
CATGCAGCGCACAAAAGTTAAAGTGGAAAAGGAGGCAGACGATGAGCAGA
GCAGGGCACTGTACTCCAACGAGATCAACCAGAAGATGCTCAATTCCACC
TCGAATTTTGTGGTGGAGTCCAGCTACTCGATATGCGCCGGCCTGATAGA
CGGACGCCTCAGTTTCCGCGGCATGAATCCGGAGCTAGAACTTCTCATGG
AGCAGGATCTGGCGGAAAAGCAGGGCCGCACAAGGCCGGAGCAGCCCAAG
GAGGTATCCGACCAAGACATGGTAAAGGCTTATTATGCCAACAAGGCGCC
CACGGTCTCCGGCAGCATGAGCAAGAAGTTTAACACCAAAAAGGACTTTA
AAAGGAAGCAAATCGGCGGAGATAGTGATAGTCCGCATGCCATGAAGAAG
CAGTACTTTAAGAAACCACGCTCGGGTGACGAATAGTTTACTACTTAGTT
GTTACACTCGTGACTTAGCTTTTAGTTAAATAAATATACGAATTCAATTG
TAAAAAAAAAAAAAAAA

RE45276.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Mpp6-RA 812 Mpp6-RA 4..652 4..652 3245 100 Plus
CG9249-RA 1140 CG9249-RA 980..1140 652..492 805 100 Minus
CG9249-RB 1163 CG9249-RB 1003..1163 652..492 805 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21155382..21156029 4..651 3240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21156877..21157525 4..652 3245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21156877..21157525 4..652 3245 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:20:13 has no hits.

RE45276.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:22 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21155379..21156029 1..651 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:16 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..489 98..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:54 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..489 98..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:11:12 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..489 98..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:15 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..489 98..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:05 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..489 98..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:14 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..651 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:53 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..651 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:12 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 30..680 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:15 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 1..651 1..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:05 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
Mpp6-RA 524..1174 1..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:22 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21156874..21157524 1..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:22 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21156874..21157524 1..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:22 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21156874..21157524 1..651 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:12 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21156874..21157524 1..651 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:04 Download gff for RE45276.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21156874..21157524 1..651 99   Plus

RE45276.hyp Sequence

Translation from 97 to 585

> RE45276.hyp
MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNS
TSNFVVESSYSICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQP
KEVSDQDMVKAYYANKAPTVSGSMSKKFNTKKDFKRKQIGGDSDSPHAMK
KQYFKKPRSGDE*

RE45276.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Mpp6-PB 162 CG9250-PB 1..162 1..162 828 100 Plus
Mpp6-PA 162 CG9250-PA 1..162 1..162 828 100 Plus

RE45276.pep Sequence

Translation from 97 to 585

> RE45276.pep
MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNS
TSNFVVESSYSICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQP
KEVSDQDMVKAYYANKAPTVSGSMSKKFNTKKDFKRKQIGGDSDSPHAMK
KQYFKKPRSGDE*

RE45276.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14740-PA 163 GF14740-PA 1..163 1..162 618 73 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21282-PA 162 GG21282-PA 1..162 1..162 711 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13671-PA 156 GH13671-PA 1..153 1..161 506 64.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Mpp6-PB 162 CG9250-PB 1..162 1..162 828 100 Plus
Mpp6-PA 162 CG9250-PA 1..162 1..162 828 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17099-PA 159 GI17099-PA 1..158 1..162 600 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25892-PA 159 GL25892-PA 1..158 1..162 616 72.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21645-PA 159 GA21645-PA 1..158 1..162 614 71.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23394-PA 162 GM23394-PA 1..162 1..162 817 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24304-PA 162 GD24304-PA 1..162 1..162 821 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16137-PA 164 GJ16137-PA 1..155 1..158 557 72.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21112-PA 161 GK21112-PA 1..158 1..162 568 69.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12899-PA 161 GE12899-PA 1..161 1..162 775 91.4 Plus