BDGP Sequence Production Resources |
Search the DGRC for RE45276
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 452 |
Well: | 76 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Mpp6-RA |
Protein status: | RE45276.pep: gold |
Preliminary Size: | 444 |
Sequenced Size: | 667 |
Gene | Date | Evidence |
---|---|---|
CG9250 | 2002-01-01 | Sim4 clustering to Release 2 |
CG9250 | 2002-04-26 | Blastp of sequenced clone |
CG9250 | 2003-01-01 | Sim4 clustering to Release 3 |
Mpp6 | 2008-04-29 | Release 5.5 accounting |
Mpp6 | 2008-08-15 | Release 5.9 accounting |
Mpp6 | 2008-12-18 | 5.12 accounting |
667 bp (667 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113483
> RE45276.complete CTTCTTTTGAAAAAAATTAAATGTGCCTGATGGTTTCGCCCTAGTTTTTA AACTCAAAGGACTTCTACTATATTAGATTCAAAAATAAATAAGGAAAATG CCATCCAAATCAAAGCCGAGACTTTCGCGTGGTGTCCTGGACATGAAGTT CATGCAGCGCACAAAAGTTAAAGTGGAAAAGGAGGCAGACGATGAGCAGA GCAGGGCACTGTACTCCAACGAGATCAACCAGAAGATGCTCAATTCCACC TCGAATTTTGTGGTGGAGTCCAGCTACTCGATATGCGCCGGCCTGATAGA CGGACGCCTCAGTTTCCGCGGCATGAATCCGGAGCTAGAACTTCTCATGG AGCAGGATCTGGCGGAAAAGCAGGGCCGCACAAGGCCGGAGCAGCCCAAG GAGGTATCCGACCAAGACATGGTAAAGGCTTATTATGCCAACAAGGCGCC CACGGTCTCCGGCAGCATGAGCAAGAAGTTTAACACCAAAAAGGACTTTA AAAGGAAGCAAATCGGCGGAGATAGTGATAGTCCGCATGCCATGAAGAAG CAGTACTTTAAGAAACCACGCTCGGGTGACGAATAGTTTACTACTTAGTT GTTACACTCGTGACTTAGCTTTTAGTTAAATAAATATACGAATTCAATTG TAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 21155382..21156029 | 4..651 | 3240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21156877..21157525 | 4..652 | 3245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21156877..21157525 | 4..652 | 3245 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 21155379..21156029 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..489 | 98..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..489 | 98..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..489 | 98..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..489 | 98..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..489 | 98..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..651 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..651 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 30..680 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 1..651 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Mpp6-RA | 524..1174 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21156874..21157524 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21156874..21157524 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21156874..21157524 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 21156874..21157524 | 1..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21156874..21157524 | 1..651 | 99 | Plus |
Translation from 97 to 585
> RE45276.hyp MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNS TSNFVVESSYSICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQP KEVSDQDMVKAYYANKAPTVSGSMSKKFNTKKDFKRKQIGGDSDSPHAMK KQYFKKPRSGDE*
Translation from 97 to 585
> RE45276.pep MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNS TSNFVVESSYSICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQP KEVSDQDMVKAYYANKAPTVSGSMSKKFNTKKDFKRKQIGGDSDSPHAMK KQYFKKPRSGDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14740-PA | 163 | GF14740-PA | 1..163 | 1..162 | 618 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21282-PA | 162 | GG21282-PA | 1..162 | 1..162 | 711 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13671-PA | 156 | GH13671-PA | 1..153 | 1..161 | 506 | 64.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Mpp6-PB | 162 | CG9250-PB | 1..162 | 1..162 | 828 | 100 | Plus |
Mpp6-PA | 162 | CG9250-PA | 1..162 | 1..162 | 828 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17099-PA | 159 | GI17099-PA | 1..158 | 1..162 | 600 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25892-PA | 159 | GL25892-PA | 1..158 | 1..162 | 616 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21645-PA | 159 | GA21645-PA | 1..158 | 1..162 | 614 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23394-PA | 162 | GM23394-PA | 1..162 | 1..162 | 817 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24304-PA | 162 | GD24304-PA | 1..162 | 1..162 | 821 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16137-PA | 164 | GJ16137-PA | 1..155 | 1..158 | 557 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21112-PA | 161 | GK21112-PA | 1..158 | 1..162 | 568 | 69.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12899-PA | 161 | GE12899-PA | 1..161 | 1..162 | 775 | 91.4 | Plus |