Clone RE45353 Report

Search the DGRC for RE45353

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:453
Well:53
Vector:pFlc-1
Associated Gene/TranscriptCG15254-RA
Protein status:RE45353.pep: gold
Preliminary Size:808
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15254 2002-01-01 Sim4 clustering to Release 2
CG15254 2002-04-26 Blastp of sequenced clone
CG15254 2003-01-01 Sim4 clustering to Release 3
CG15254 2008-04-29 Release 5.5 accounting
CG15254 2008-08-15 Release 5.9 accounting
CG15254 2008-12-18 5.12 accounting

Clone Sequence Records

RE45353.complete Sequence

838 bp (838 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113485

> RE45353.complete
AAAACAGTAACTTGCTGATCGCAGAGCCATCAACATGAAGACCTGGGCCT
TAACTTTAGTGGTCATATTCTTGGCCAGCTCCTGCTCGGCAGCTCCCACC
ACACAGAACAGGATAGAAACCGATCCTGAACTGACAGCTGGCTATATTGA
AGGCGACATGGTGCCCAGTCCGGAGGGAAGGAACGGACTTCGCAATGAAA
CCTTCAGATGGCCAAACCGCATTGTCTATTATTACATCAATCGCGATATT
GACACCGAGCATCGCAACCATATTCTAAGAGGTATTCGCATAATAGAACA
AAGTTCTTGCTTGGTCTTCAAGGAGGCCACCACTGATCAGGAATATTATG
TGAATGTTACCTCGGAGGCTGGAGGATGTTACTCGTATGTTGGCTATCGC
AACCGGGTTCAGCAGCTGAATCTGCAGACCTACGCTCTGGACACCGGCTG
CTTCCGTCTGGGAACAATTGTCCACGAGTTCCTGCATGCCCTTGGCTTCT
ATCACCAGCAAAGCACCTGGAATCGCGATGACTATGTCCGAATTGCTGAG
GAAAACATAACTGAGGGCACTGAGGGCAACTTCAACAAGTACGACAATGA
AACCGTCGAGGACTACGGAGAACCCTATGATTACTCCAGTGTACTACACT
ACACCGCTTATGCGTTCTCTAAAAACGGAGAGATGACCATTGTGCCGCTA
CAGGAAGGTGCCGAAGAACTTATGGGGCAGCGATTGCAAATGACCCAGTC
GGATATTAACAAACTTAACGTCATGTACAAGTGCCCCAGGCAGGTGTAAT
AAATAGAAAGAGATCATAACGCAAAAAAAAAAAAAAAA

RE45353.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15254-RA 1030 CG15254-RA 156..979 2..825 4120 100 Plus
CG15253-RA 1047 CG15253-RA 219..456 191..428 290 74.7 Plus
CG15253-RA 1047 CG15253-RA 139..197 111..169 205 89.8 Plus
CG15253-RA 1047 CG15253-RA 473..597 445..569 160 75.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15612659..15613230 822..251 2860 100 Minus
chr2L 23010047 chr2L 15613286..15613535 251..2 1250 100 Minus
chr2L 23010047 chr2L 15614463..15614716 569..316 295 74.4 Minus
chr2L 23010047 chr2L 15614916..15614974 169..111 205 89.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15613945..15614519 825..251 2875 100 Minus
2L 23513712 2L 15614575..15614824 251..2 1250 100 Minus
2L 23513712 2L 15615752..15616005 569..316 295 74.4 Minus
2L 23513712 2L 15616205..15616263 169..111 205 89.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15613945..15614519 825..251 2875 100 Minus
2L 23513712 2L 15614575..15614824 251..2 1250 100 Minus
2L 23513712 2L 15615893..15616005 428..316 220 79.6 Minus
2L 23513712 2L 15616205..15616263 169..111 205 89.8 Minus
2L 23513712 2L 15615752..15615876 569..445 160 75.2 Minus
Blast to na_te.dros performed on 2019-03-16 19:14:46 has no hits.

RE45353.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:15:24 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15612659..15613229 252..822 100 <- Minus
chr2L 15613286..15613535 1..251 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:20 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..765 35..799 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:56 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..765 35..799 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:36 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..765 35..799 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:17 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..765 35..799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:24:58 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..765 35..799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:18 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..821 2..822 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:56 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..821 2..822 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:36 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 4..825 1..822 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:17 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 1..821 2..822 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:24:58 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
CG15254-RA 4..825 1..822 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:24 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15613948..15614518 252..822 100 <- Minus
2L 15614575..15614824 1..251 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:24 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15613948..15614518 252..822 100 <- Minus
2L 15614575..15614824 1..251 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:24 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15613948..15614518 252..822 100 <- Minus
2L 15614575..15614824 1..251 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:36 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15614575..15614824 1..251 99   Minus
arm_2L 15613948..15614518 252..822 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:07 Download gff for RE45353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15614575..15614824 1..251 99   Minus
2L 15613948..15614518 252..822 100 <- Minus

RE45353.pep Sequence

Translation from 34 to 798

> RE45353.pep
MKTWALTLVVIFLASSCSAAPTTQNRIETDPELTAGYIEGDMVPSPEGRN
GLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATT
DQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFL
HALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDY
SSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC
PRQV*

RE45353.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13897-PA 254 GF13897-PA 1..254 1..254 1214 85.8 Plus
Dana\GF13868-PA 255 GF13868-PA 8..255 10..254 617 49 Plus
Dana\GF13899-PA 260 GF13899-PA 28..257 30..251 588 47.4 Plus
Dana\GF13898-PA 251 GF13898-PA 23..248 30..251 482 42.3 Plus
Dana\GF22400-PA 360 GF22400-PA 115..325 35..249 422 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24203-PA 254 GG24203-PA 1..254 1..254 1269 94.9 Plus
Dere\GG24202-PA 253 GG24202-PA 1..249 1..251 898 65.7 Plus
Dere\GG25167-PA 254 GG25167-PA 2..254 1..254 626 48.8 Plus
Dere\GG24205-PA 261 GG24205-PA 4..258 5..251 612 46.1 Plus
Dere\GG24204-PA 250 GG24204-PA 2..247 4..251 584 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13110-PA 252 GH13110-PA 1..252 1..254 1010 70.5 Plus
Dgri\GH13111-PA 252 GH13111-PA 1..252 1..254 890 62.2 Plus
Dgri\GH13765-PA 256 GH13765-PA 11..256 8..254 617 49.4 Plus
Dgri\GH13112-PA 262 GH13112-PA 30..259 30..251 605 48.3 Plus
Dgri\GH12202-PA 314 GH12202-PA 71..280 36..249 409 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15254-PB 254 CG15254-PB 1..254 1..254 1359 100 Plus
CG15254-PA 254 CG15254-PA 1..254 1..254 1359 100 Plus
CG15253-PA 253 CG15253-PA 4..249 4..251 890 66.5 Plus
CG7631-PA 254 CG7631-PA 2..254 1..254 627 48.8 Plus
CG15255-PB 261 CG15255-PB 28..258 30..251 591 48.9 Plus
CG15255-PA 261 CG15255-PA 28..258 30..251 591 48.9 Plus
Semp1-PA 251 CG11864-PA 8..251 10..254 551 48.4 Plus
CG6696-PA 324 CG6696-PA 81..290 36..249 409 41.7 Plus
CG6763-PB 354 CG6763-PB 83..302 28..250 380 38.3 Plus
CG6763-PA 354 CG6763-PA 83..302 28..250 380 38.3 Plus
CG11865-PA 240 CG11865-PA 4..239 6..248 356 38.1 Plus
CG5715-PA 295 CG5715-PA 68..293 30..250 354 35.1 Plus
tok-PC 1464 CG6863-PC 529..722 59..252 283 31.8 Plus
tok-PA 1464 CG6863-PA 529..722 59..252 283 31.8 Plus
tok-PB 1464 CG6863-PB 529..722 59..252 283 31.8 Plus
CG10280-PA 356 CG10280-PA 107..338 30..250 274 32.3 Plus
CG10280-PB 362 CG10280-PB 113..344 30..250 274 32.3 Plus
tld-PA 1067 CG6868-PA 146..337 59..250 239 29.6 Plus
CG6974-PA 251 CG6974-PA 47..251 49..250 236 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22585-PA 254 GI22585-PA 1..254 1..254 1042 74.1 Plus
Dmoj\GI22607-PA 249 GI22607-PA 18..244 27..254 960 76.3 Plus
Dmoj\GI22596-PA 264 GI22596-PA 36..264 26..254 875 67.2 Plus
Dmoj\GI22574-PA 262 GI22574-PA 14..262 1..254 806 60.2 Plus
Dmoj\GI17904-PA 250 GI17904-PA 1..250 1..254 698 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26587-PA 253 GL26587-PA 15..253 16..254 1176 88.7 Plus
Dper\GL26586-PA 250 GL26586-PA 24..250 26..252 868 70 Plus
Dper\GL26434-PA 250 GL26434-PA 4..250 3..254 625 50.4 Plus
Dper\GL26435-PA 260 GL26435-PA 18..259 11..253 607 49.8 Plus
Dper\GL26591-PA 262 GL26591-PA 4..259 6..251 607 46.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13604-PA 253 GA13604-PA 15..253 16..254 1179 89.1 Plus
Dpse\GA13603-PA 250 GA13603-PA 24..250 26..252 868 70 Plus
Dpse\GA20493-PA 250 GA20493-PA 4..250 3..254 621 50 Plus
Dpse\GA13605-PA 262 GA13605-PA 4..259 6..251 620 47.3 Plus
Dpse\GA28862-PA 239 GA28862-PA 18..238 11..253 511 44.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14287-PA 254 GM14287-PA 1..254 1..254 1292 94.1 Plus
Dsec\GM16106-PA 254 GM16106-PA 2..254 1..254 628 48.8 Plus
Dsec\GM14306-PA 261 GM14306-PA 28..258 30..251 596 48.5 Plus
Dsec\GM14297-PA 251 GM14297-PA 4..248 2..251 564 48.6 Plus
Dsec\GM14276-PA 117 GM14276-PA 1..117 42..158 463 72.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21949-PA 254 GD21949-PA 1..254 1..254 1353 97.6 Plus
Dsim\GD21948-PA 253 GD21948-PA 19..249 19..251 893 71.2 Plus
Dsim\GD24016-PA 254 GD24016-PA 2..254 1..254 638 49.6 Plus
Dsim\GD21951-PA 261 GD21951-PA 28..258 30..251 596 48.5 Plus
Dsim\GD21950-PA 251 GD21950-PA 4..248 2..251 566 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23159-PA 265 GJ23159-PA 21..265 8..254 1053 77.7 Plus
Dvir\GJ23170-PA 252 GJ23170-PA 1..252 1..254 927 66.1 Plus
Dvir\GJ23181-PA 263 GJ23181-PA 6..260 7..251 634 46.1 Plus
Dvir\GJ23077-PA 255 GJ23077-PA 5..255 4..254 597 48.8 Plus
Dvir\GJ17413-PA 270 GJ17413-PA 32..246 39..253 477 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18246-PA 256 GK18246-PA 1..256 1..254 1063 78.1 Plus
Dwil\GK18245-PA 251 GK18245-PA 1..251 1..251 891 65.6 Plus
Dwil\GK18143-PA 259 GK18143-PA 4..259 3..254 611 49.2 Plus
Dwil\GK18907-PA 264 GK18907-PA 30..261 30..251 611 49.1 Plus
Dwil\GK24951-PA 316 GK24951-PA 73..282 36..249 399 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19397-PA 254 GE19397-PA 1..254 1..254 1320 96.1 Plus
Dyak\BG:BACR44L22.3-PA 252 GE19396-PA 8..248 6..251 908 70.3 Plus
Dyak\GE21078-PA 254 GE21078-PA 4..254 3..254 645 50.4 Plus
Dyak\GE19399-PA 261 GE19399-PA 28..258 30..251 590 48.5 Plus
Dyak\GE19398-PA 251 GE19398-PA 2..248 4..251 556 47.4 Plus

RE45353.hyp Sequence

Translation from 34 to 798

> RE45353.hyp
MKTWALTLVVIFLASSCSAAPTTQNRIETDPELTAGYIEGDMVPSPEGRN
GLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATT
DQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFL
HALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDY
SSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC
PRQV*

RE45353.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15254-PB 254 CG15254-PB 1..254 1..254 1359 100 Plus
CG15254-PA 254 CG15254-PA 1..254 1..254 1359 100 Plus
CG15253-PA 253 CG15253-PA 4..249 4..251 890 66.5 Plus
CG7631-PA 254 CG7631-PA 2..254 1..254 627 48.8 Plus
CG15255-PB 261 CG15255-PB 28..258 30..251 591 48.9 Plus