Clone RE45749 Report

Search the DGRC for RE45749

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:457
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG31106-RB
Protein status:RE45749.pep: gold
Preliminary Size:1752
Sequenced Size:1689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13655 2002-01-01 Sim4 clustering to Release 2
CG31106 2003-01-01 Sim4 clustering to Release 3
CG31106 2008-04-29 Release 5.5 accounting
CG31106 2008-08-15 Release 5.9 accounting
CG31106 2008-12-18 5.12 accounting

Clone Sequence Records

RE45749.complete Sequence

1689 bp (1689 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024204

> RE45749.complete
CGAGTTCAAGTTTGTCGCAGGTTCGGGAATGCCAAATATCTTGAAAGTCA
ATCCAGGCGATCACTATGAGTTCGGAATCTGGCCAACAAGACGTTGAATC
GAAGCCAAAATCGGCTCGGAGTACCAGTGCTGGTCACGAATACGAGGATG
TGCTTCAGATTATTGGATTCGGGCGAGTGCAATGGATCGTCCTTTTTGCC
GCAGGACTTCTCCTGATGATGGTCATAAACGAGACCATGGGCATGTCCTA
TATTACCATAGTATCCCAGTGCGATTTTGAGATGAACTCAATGGATAAGG
CGGTCATGAGTGCTGCCAGTTTTATCGGCATATTCTGTTCATCATACTTT
TGGGGCTACCTGAGTGACACTATAGGTCGCAGACCAGTGCTAATCTATAC
GACGATCGCCGGGAATTTCTTATCCTTATGCTCCACCGTCATTCCGAACT
ACTGGCTTTATGTGTTCATTCGTTTCGGTGTTGGATTTTTCATTGCGGGA
GCATCATCAACAACCTATGCGTATCTTGGGGAATTCTTCACTCCCCGTCA
TCGACCAATCGCCATTAATTACGCCAGTCTCTTCGTGGGTGTGTCCACTG
TCTATGTTCCAGCTACCGCCTGGCTAATACTTTCGATGGACTGGAGTGTC
AGTATAACCGATGGCTTCTCCTTACGTCCTTGGAGACTGCTGACCATATG
CTACTTGCTGCCTGGTGTCGTGGGCACATTGATGTTGTGGTCGCTTCCCG
AGAGTCCCAAGATCCTAATGTCCTTGCACAAAACTGAAGAGGCTTTTGCG
GCAGTCGATTGGATTGCAGTGACGAATTCGGGCAAACACTTACACGAATT
CAAGGTGCATAAACTAAAAACGGAAGATAACGCGAATGGGGAAAATATAC
TGCTCATATCCAAGTCAGCGTTTACAACAATCAAGAAAATGTGGAAGGAA
ACTTTGCCGCTGCTAAGAAGACCTCACTTGCTGAACTTCGTCATCAGCTG
TACGATTATGTGTGGTCTATTTTTCAGTTCTTCGGGCATGGGTCTTTGGT
ATCCAGAAATTCAAAATCGATTGGGCTCAAATGCGGCGGACGATTCAATG
ACTGTTTGCCAAGTTATTGATGCGTCAATAGATCAAATGCAAGCGAATGC
ATCCAATAAAATTTGCGACGACCACATAAATACCAAGAGCTATATAGACA
CCATTACCTATGGATCGGCCCTAATAGTTGGCTATATCTTGATGGGTCTT
GTTATAAACACGATTGGTCGCAAGGCCTCGATTTCAATTGGATTAACTCT
AGCTGGAGCTTGTGCAATAGCATTGATCTTTATAAAGGACGAGGTGGCCA
TAGTGGTTTGCTTCTGCTTGTATCTGGTACTACCGGGACTTTGTGTCTCC
ATTCTGAGTGGAGCAGTCGTCGATTTGGTGCCCACCCATCTGCGCGGAAA
AGCGGTGTGCATTTGCCTGATGCTGGGACGCACGGGAAGTGTTTTCGGTA
GTAATATCATCGGAGTGCTCCTGGAATCCTATTGCTCTCTAACTTTCGGG
GTATTCTCTGGATTTGTGCTGGTATGTGCAAGTCTGACGTTACTGTTGCC
TATTTAAGATTGGCCACTATAGTTTAAGTAGCTAAGTTTAATTTAAGTTC
CAAAATAAATTAGAATGTTTAGGAAAAAAAAAAAAAAAA

RE45749.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31106.a 2159 CG31106.a 298..1972 3..1677 8375 100 Plus
CG31106-RB 1950 CG31106-RB 89..1763 3..1677 8375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21041215..21041626 1161..1572 2045 99.8 Plus
chr3R 27901430 chr3R 21040475..21040785 611..921 1540 99.7 Plus
chr3R 27901430 chr3R 21039618..21039781 165..328 820 100 Plus
chr3R 27901430 chr3R 21039388..21039551 3..166 805 99.4 Plus
chr3R 27901430 chr3R 21039867..21040030 327..490 775 98.2 Plus
chr3R 27901430 chr3R 21041015..21041150 1025..1160 665 99.3 Plus
chr3R 27901430 chr3R 21040299..21040420 491..612 610 100 Plus
chr3R 27901430 chr3R 21040847..21040954 920..1027 540 100 Plus
chr3R 27901430 chr3R 21041693..21041794 1572..1673 480 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25218129..25218540 1161..1572 2060 100 Plus
3R 32079331 3R 25217389..25217699 611..921 1555 100 Plus
3R 32079331 3R 25216302..25216465 3..166 820 100 Plus
3R 32079331 3R 25216532..25216695 165..328 820 100 Plus
3R 32079331 3R 25216781..25216944 327..490 820 100 Plus
3R 32079331 3R 25217929..25218064 1025..1160 680 100 Plus
3R 32079331 3R 25217212..25217333 491..612 610 100 Plus
3R 32079331 3R 25217761..25217868 920..1027 540 100 Plus
3R 32079331 3R 25218607..25218712 1572..1677 530 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24958960..24959371 1161..1572 2060 100 Plus
3R 31820162 3R 24958220..24958530 611..921 1555 100 Plus
3R 31820162 3R 24957612..24957775 327..490 820 100 Plus
3R 31820162 3R 24957363..24957526 165..328 820 100 Plus
3R 31820162 3R 24957133..24957296 3..166 820 100 Plus
3R 31820162 3R 24958760..24958895 1025..1160 680 100 Plus
3R 31820162 3R 24958043..24958164 491..612 610 100 Plus
3R 31820162 3R 24958592..24958699 920..1027 540 100 Plus
3R 31820162 3R 24959438..24959543 1572..1677 530 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:10:26 has no hits.

RE45749.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:11:09 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21039387..21039550 1..165 98 -> Plus
chr3R 21039619..21039780 166..327 100 -> Plus
chr3R 21039868..21040030 328..490 98 -> Plus
chr3R 21040299..21040420 491..612 100 -> Plus
chr3R 21040477..21040783 613..919 99 -> Plus
chr3R 21040847..21040954 920..1027 100 -> Plus
chr3R 21041018..21041150 1028..1160 99 -> Plus
chr3R 21041215..21041626 1161..1572 99 -> Plus
chr3R 21041694..21041794 1573..1673 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:29 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RA 1..1548 66..1607 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:59 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 1..1542 66..1607 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:11 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 1..1542 66..1607 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:11:47 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RA 1..1548 66..1607 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:59:49 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 1..1542 66..1607 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:08:45 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RA 3..1674 1..1667 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:58 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 3..1674 1..1673 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:11 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 5..1676 1..1673 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:11:48 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RA 3..1674 1..1667 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:59:49 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
CG31106-RB 5..1676 1..1673 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:09 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25216301..25216464 1..165 99 -> Plus
3R 25216533..25216694 166..327 100 -> Plus
3R 25216782..25216944 328..490 100 -> Plus
3R 25217212..25217333 491..612 100 -> Plus
3R 25217391..25217697 613..919 100 -> Plus
3R 25217761..25217868 920..1027 100 -> Plus
3R 25217932..25218064 1028..1160 100 -> Plus
3R 25218129..25218540 1161..1572 100 -> Plus
3R 25218608..25218708 1573..1673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:09 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25216301..25216464 1..165 99 -> Plus
3R 25216533..25216694 166..327 100 -> Plus
3R 25216782..25216944 328..490 100 -> Plus
3R 25217212..25217333 491..612 100 -> Plus
3R 25217391..25217697 613..919 100 -> Plus
3R 25217761..25217868 920..1027 100 -> Plus
3R 25217932..25218064 1028..1160 100 -> Plus
3R 25218129..25218540 1161..1572 100 -> Plus
3R 25218608..25218708 1573..1673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:09 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25216301..25216464 1..165 99 -> Plus
3R 25216533..25216694 166..327 100 -> Plus
3R 25216782..25216944 328..490 100 -> Plus
3R 25217212..25217333 491..612 100 -> Plus
3R 25217391..25217697 613..919 100 -> Plus
3R 25217761..25217868 920..1027 100 -> Plus
3R 25217932..25218064 1028..1160 100 -> Plus
3R 25218129..25218540 1161..1572 100 -> Plus
3R 25218608..25218708 1573..1673 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:11 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21042255..21042416 166..327 100 -> Plus
arm_3R 21042504..21042666 328..490 100 -> Plus
arm_3R 21042934..21043055 491..612 100 -> Plus
arm_3R 21044330..21044430 1573..1673 100   Plus
arm_3R 21042023..21042186 1..165 99 -> Plus
arm_3R 21043113..21043419 613..919 100 -> Plus
arm_3R 21043483..21043590 920..1027 100 -> Plus
arm_3R 21043654..21043786 1028..1160 100 -> Plus
arm_3R 21043851..21044262 1161..1572 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:00:20 Download gff for RE45749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24958222..24958528 613..919 100 -> Plus
3R 24958592..24958699 920..1027 100 -> Plus
3R 24958763..24958895 1028..1160 100 -> Plus
3R 24958960..24959371 1161..1572 100 -> Plus
3R 24959439..24959539 1573..1673 100   Plus
3R 24957364..24957525 166..327 100 -> Plus
3R 24957613..24957775 328..490 100 -> Plus
3R 24958043..24958164 491..612 100 -> Plus
3R 24957132..24957295 1..165 99 -> Plus

RE45749.pep Sequence

Translation from 65 to 1606

> RE45749.pep
MSSESGQQDVESKPKSARSTSAGHEYEDVLQIIGFGRVQWIVLFAAGLLL
MMVINETMGMSYITIVSQCDFEMNSMDKAVMSAASFIGIFCSSYFWGYLS
DTIGRRPVLIYTTIAGNFLSLCSTVIPNYWLYVFIRFGVGFFIAGASSTT
YAYLGEFFTPRHRPIAINYASLFVGVSTVYVPATAWLILSMDWSVSITDG
FSLRPWRLLTICYLLPGVVGTLMLWSLPESPKILMSLHKTEEAFAAVDWI
AVTNSGKHLHEFKVHKLKTEDNANGENILLISKSAFTTIKKMWKETLPLL
RRPHLLNFVISCTIMCGLFFSSSGMGLWYPEIQNRLGSNAADDSMTVCQV
IDASIDQMQANASNKICDDHINTKSYIDTITYGSALIVGYILMGLVINTI
GRKASISIGLTLAGACAIALIFIKDEVAIVVCFCLYLVLPGLCVSILSGA
VVDLVPTHLRGKAVCICLMLGRTGSVFGSNIIGVLLESYCSLTFGVFSGF
VLVCASLTLLLPI*

RE45749.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17899-PA 518 GF17899-PA 1..518 1..513 2269 84.8 Plus
Dana\GF17900-PA 511 GF17900-PA 14..501 25..512 1117 44.1 Plus
Dana\GF24246-PA 486 GF24246-PA 5..483 25..512 638 29.6 Plus
Dana\GF17931-PA 482 GF17931-PA 1..443 51..491 637 31.9 Plus
Dana\GF17930-PA 455 GF17930-PA 1..436 58..491 619 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11374-PA 513 GG11374-PA 1..513 1..513 2533 96.3 Plus
Dere\GG11375-PA 360 GG11375-PA 16..347 25..357 704 43.2 Plus
Dere\GG16821-PA 484 GG16821-PA 2..472 24..492 629 31 Plus
Dere\GG14882-PA 482 GG14882-PA 5..478 25..512 565 26.2 Plus
Dere\GG18441-PA 529 GG18441-PA 4..498 12..512 535 26.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18056-PA 512 GH18056-PA 1..504 1..502 1877 68.5 Plus
Dgri\GH18057-PA 360 GH18057-PA 6..353 16..363 709 40.5 Plus
Dgri\GH16263-PA 779 GH16263-PA 302..762 29..503 559 27 Plus
Dgri\GH24388-PA 533 GH24388-PA 11..503 11..512 533 27.2 Plus
Dgri\GH11966-PA 620 GH11966-PA 123..612 25..512 476 24.2 Plus
Dgri\GH16263-PA 779 GH16263-PA 7..239 27..259 377 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31106-PB 513 CG31106-PB 1..513 1..513 2651 100 Plus
CG31103-PB 506 CG31103-PB 16..502 25..513 1097 43.7 Plus
CG12783-PC 465 CG12783-PC 1..465 51..513 615 31.2 Plus
CG12783-PB 465 CG12783-PB 1..465 51..513 615 31.2 Plus
CG33233-PC 489 CG33233-PC 5..484 25..512 609 27.6 Plus
CG15221-PB 545 CG15221-PB 22..514 7..512 560 25.9 Plus
CG31272-PA 563 CG31272-PA 25..555 6..512 533 26.5 Plus
CG3168-PG 632 CG3168-PG 137..624 26..512 518 25.7 Plus
CG3168-PF 632 CG3168-PF 137..624 26..512 518 25.7 Plus
CG3168-PE 632 CG3168-PE 137..624 26..512 518 25.7 Plus
CG3168-PD 632 CG3168-PD 137..624 26..512 518 25.7 Plus
CG3168-PB 632 CG3168-PB 137..624 26..512 518 25.7 Plus
CG3168-PA 632 CG3168-PA 137..624 26..512 518 25.7 Plus
CG3168-PC 632 CG3168-PC 137..624 26..512 518 25.7 Plus
CG33234-PD 475 CG33234-PD 3..465 25..512 505 27.6 Plus
CG33234-PE 473 CG33234-PE 3..457 25..504 504 27.6 Plus
CG3690-PB 558 CG3690-PB 28..551 22..513 468 25.3 Plus
CG3690-PA 558 CG3690-PA 28..551 22..513 468 25.3 Plus
CG14691-PA 522 CG14691-PA 8..515 19..513 436 23.9 Plus
CG14691-PB 510 CG14691-PB 8..503 19..513 396 23.7 Plus
CG14691-PC 373 CG14691-PC 8..364 19..365 318 23.9 Plus
Orct-PB 548 CG6331-PB 126..504 78..512 200 22.4 Plus
Orct-PA 548 CG6331-PA 126..504 78..512 200 22.4 Plus
CG8654-PD 502 CG8654-PD 93..466 64..498 195 22.6 Plus
CG8654-PC 502 CG8654-PC 93..466 64..498 195 22.6 Plus
CG8654-PB 502 CG8654-PB 93..466 64..498 195 22.6 Plus
CG8654-PA 502 CG8654-PA 93..466 64..498 195 22.6 Plus
Orct2-PB 567 CG13610-PB 131..510 79..512 185 21.5 Plus
Orct2-PA 567 CG13610-PA 131..510 79..512 185 21.5 Plus
CG42269-PE 662 CG42269-PE 212..577 86..459 160 23.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23733-PA 511 GI23733-PA 6..499 7..501 2008 73.3 Plus
Dmoj\GI23734-PA 483 GI23734-PA 3..477 25..498 1007 41.2 Plus
Dmoj\GI15327-PA 477 GI15327-PA 1..455 51..512 530 29.2 Plus
Dmoj\GI13199-PA 458 GI13199-PA 4..447 24..512 513 27.6 Plus
Dmoj\GI23893-PA 563 GI23893-PA 20..555 7..512 492 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27291-PA 497 GL27291-PA 7..497 25..513 731 32 Plus
Dper\GL21913-PA 374 GL21913-PA 16..340 25..351 718 42.7 Plus
Dper\GL18412-PA 474 GL18412-PA 2..473 25..512 602 31.7 Plus
Dper\GL12623-PA 562 GL12623-PA 24..554 5..512 501 25.3 Plus
Dper\GL18413-PA 408 GL18413-PA 2..396 97..504 469 30 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16011-PB 504 GA16011-PB 2..500 7..513 1050 42 Plus
Dpse\GA11809-PB 465 GA11809-PB 1..465 51..513 670 31 Plus
Dpse\GA29305-PA 492 GA29305-PA 9..490 5..504 591 31.2 Plus
Dpse\GA13582-PA 546 GA13582-PA 12..508 12..512 538 27 Plus
Dpse\GA29306-PA 464 GA29306-PA 3..452 25..512 519 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17817-PA 512 GM17817-PA 1..512 1..513 2636 97.7 Plus
Dsec\GM17818-PA 360 GM17818-PA 16..349 25..359 714 44.4 Plus
Dsec\GM15418-PA 488 GM15418-PA 2..473 24..493 637 31.7 Plus
Dsec\GM14506-PA 489 GM14506-PA 5..484 25..512 596 28.3 Plus
Dsec\GM13106-PA 541 GM13106-PA 18..492 7..494 538 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21186-PA 513 GD21186-PA 1..513 1..513 2680 98.8 Plus
Dsim\GD21187-PA 360 GD21187-PA 16..347 25..357 722 45.5 Plus
Dsim\GD20276-PA 488 GD20276-PA 2..472 24..492 630 31.6 Plus
Dsim\GD13703-PA 489 GD13703-PA 5..484 25..512 595 27.4 Plus
Dsim\GD20707-PA 537 GD20707-PA 25..519 6..476 484 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10577-PA 515 GJ10577-PA 1..515 1..513 2027 71.8 Plus
Dvir\GJ10580-PA 451 GJ10580-PA 15..451 25..460 946 42.5 Plus
Dvir\GJ15101-PA 464 GJ15101-PA 1..464 51..513 705 32.1 Plus
Dvir\GJ11975-PA 455 GJ11975-PA 2..449 22..512 582 29.7 Plus
Dvir\GJ23986-PA 563 GJ23986-PA 13..555 2..512 501 25.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13894-PA 704 GK13894-PA 227..704 34..513 2157 83.8 Plus
Dwil\GK13895-PA 507 GK13895-PA 6..503 16..513 1031 41.5 Plus
Dwil\GK11975-PA 485 GK11975-PA 15..481 25..513 956 39.9 Plus
Dwil\GK22833-PA 496 GK22833-PA 6..496 24..513 715 31.5 Plus
Dwil\GK13908-PA 572 GK13908-PA 33..564 12..512 535 26.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23571-PA 513 GE23571-PA 1..513 1..513 2658 97.9 Plus
Dyak\GE23572-PA 360 GE23572-PA 16..347 25..357 748 44.9 Plus
Dyak\GE26138-PA 463 GE26138-PA 1..444 51..492 556 31 Plus
Dyak\GE20334-PA 508 GE20334-PA 5..469 25..498 537 27 Plus
Dyak\GE15663-PA 533 GE15663-PA 9..484 7..494 521 26.1 Plus

RE45749.hyp Sequence

Translation from 65 to 1606

> RE45749.hyp
MSSESGQQDVESKPKSARSTSAGHEYEDVLQIIGFGRVQWIVLFAAGLLL
MMVINETMGMSYITIVSQCDFEMNSMDKAVMSAASFIGIFCSSYFWGYLS
DTIGRRPVLIYTTIAGNFLSLCSTVIPNYWLYVFIRFGVGFFIAGASSTT
YAYLGEFFTPRHRPIAINYASLFVGVSTVYVPATAWLILSMDWSVSITDG
FSLRPWRLLTICYLLPGVVGTLMLWSLPESPKILMSLHKTEEAFAAVDWI
AVTNSGKHLHEFKVHKLKTEDNANGENILLISKSAFTTIKKMWKETLPLL
RRPHLLNFVISCTIMCGLFFSSSGMGLWYPEIQNRLGSNAADDSMTVCQV
IDASIDQMQANASNKICDDHINTKSYIDTITYGSALIVGYILMGLVINTI
GRKASISIGLTLAGACAIALIFIKDEVAIVVCFCLYLVLPGLCVSILSGA
VVDLVPTHLRGKAVCICLMLGRTGSVFGSNIIGVLLESYCSLTFGVFSGF
VLVCASLTLLLPI*

RE45749.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31106-PB 513 CG31106-PB 1..513 1..513 2651 100 Plus
CG31103-PB 506 CG31103-PB 16..502 25..513 1097 43.7 Plus
CG12783-PC 465 CG12783-PC 1..465 51..513 615 31.2 Plus
CG12783-PB 465 CG12783-PB 1..465 51..513 615 31.2 Plus
CG33233-PC 489 CG33233-PC 5..484 25..512 609 27.6 Plus