Clone RE45833 Report

Search the DGRC for RE45833

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:458
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG5676-RA
Protein status:RE45833.pep: gold
Preliminary Size:620
Sequenced Size:784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5676 2002-01-01 Sim4 clustering to Release 2
CG5676 2002-06-10 Blastp of sequenced clone
CG5676 2003-01-01 Sim4 clustering to Release 3
CG5676 2008-04-29 Release 5.5 accounting
CG5676 2008-08-15 Release 5.9 accounting
CG5676 2008-12-18 5.12 accounting

Clone Sequence Records

RE45833.complete Sequence

784 bp (784 high quality bases) assembled on 2002-06-10

GenBank Submission: BT011027

> RE45833.complete
ATTGTGTTAAATTGACGTAAACTGGGCGGTCAGAATTTCGCATCTTAACG
TCGACATCTAATTTTAAAAATGACTAATTATTCGGAAATTTTTAAGAAAG
TTTTTAACGATATTGGCCAACGTTCAGCATATTCGCAGATGCTTATTGGC
GTTTCATCAGGATGGGTCACAGGATATACGACAATGAAAATAGGCAAATT
TGCTGCCTTTGCAGTTGGCGGCAGCATAATCTTGCTCGAAATCGCCCACC
AAGAAGGACTTATAAAAATAAATTGGTCTAAGTTGGATAAGAGCGTGGAT
AAGCTCGCCGATAAAGTGGAAGCCTCGCTGGGTCGTGAGAAGAACTGGAA
GGATAAGACCGAAAGATATGTCGACAATCAATTAGACAGAGCTGAAAGCC
TCCTAACCCGAAACGGCAAGAAAGTGGCGAAATGGTACACCAAACTGATT
GGCGATGAAGAGGGTCCAAAAGTCAACGATCTGCACATATTTTTGGCATC
ATTTTTCGGTGGCGTTGCCCTGGGCATTGCTACTGGATAAAAGAATTTTC
CGATTGGCACAACAAAACATTTAAATACCATATGGTTATTACGAACAAAT
CTCACTTAATAAAGTTACAAAAAAGGTAATTTAATCGAAAATCAATTGGT
TCTTTCCCAAAACATCTCAACACTCTTCGGGTTTTCGATATCATTCGTTT
TATTAAATTCTTAAACCTACTTATTTTACAGTCCATTTCGTTGAAAATAC
ATATGTATGTGTAAAAAGAAAAAAAAAAAAAAAA

RE45833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5676-RA 797 CG5676-RA 24..789 1..766 3830 100 Plus
CG5676.a 685 CG5676.a 24..648 1..625 3125 100 Plus
Ror-RA 2291 Ror-RA 2211..2291 766..686 405 100 Minus
CG5676.a 685 CG5676.a 647..683 730..766 185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10253462..10253872 766..356 2055 100 Minus
chr2L 23010047 chr2L 10253934..10254127 357..164 970 100 Minus
chr2L 23010047 chr2L 10254576..10254740 165..1 810 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10254606..10255016 766..356 2055 100 Minus
2L 23513712 2L 10255078..10255271 357..164 970 100 Minus
2L 23513712 2L 10255720..10255884 165..1 825 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10254606..10255016 766..356 2055 100 Minus
2L 23513712 2L 10255078..10255271 357..164 970 100 Minus
2L 23513712 2L 10255720..10255884 165..1 825 100 Minus
Blast to na_te.dros performed 2019-03-16 21:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 3094..3284 536..736 124 56.4 Plus

RE45833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:13:09 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10253460..10253870 358..768 99 <- Minus
chr2L 10253934..10254126 165..357 100 <- Minus
chr2L 10254577..10254740 1..164 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:30 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..471 70..540 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:04 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..471 70..540 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:29 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..471 70..540 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:30 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..471 70..540 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:11:16 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..471 70..540 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:54:15 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..766 1..768 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:03 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..762 1..762 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:29 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 8..769 1..762 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:31 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 1..766 1..768 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:16 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
CG5676-RA 8..769 1..762 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:13:09 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10254604..10255014 358..768 99 <- Minus
2L 10255078..10255270 165..357 100 <- Minus
2L 10255721..10255884 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:13:09 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10254604..10255014 358..768 99 <- Minus
2L 10255078..10255270 165..357 100 <- Minus
2L 10255721..10255884 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:13:09 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10254604..10255014 358..768 99 <- Minus
2L 10255078..10255270 165..357 100 <- Minus
2L 10255721..10255884 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:29 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10254604..10255014 358..768 99 <- Minus
arm_2L 10255078..10255270 165..357 100 <- Minus
arm_2L 10255721..10255884 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:49 Download gff for RE45833.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10254604..10255014 358..768 99 <- Minus
2L 10255078..10255270 165..357 100 <- Minus
2L 10255721..10255884 1..164 100   Minus

RE45833.hyp Sequence

Translation from 69 to 539

> RE45833.hyp
MTNYSEIFKKVFNDIGQRSAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVG
GSIILLEIAHQEGLIKINWSKLDKSVDKLADKVEASLGREKNWKDKTERY
VDNQLDRAESLLTRNGKKVAKWYTKLIGDEEGPKVNDLHIFLASFFGGVA
LGIATG*

RE45833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5676-PA 156 CG5676-PA 1..156 1..156 802 100 Plus
CG12511-PB 131 CG12511-PB 6..67 7..68 139 40.3 Plus

RE45833.pep Sequence

Translation from 69 to 539

> RE45833.pep
MTNYSEIFKKVFNDIGQRSAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVG
GSIILLEIAHQEGLIKINWSKLDKSVDKLADKVEASLGREKNWKDKTERY
VDNQLDRAESLLTRNGKKVAKWYTKLIGDEEGPKVNDLHIFLASFFGGVA
LGIATG*

RE45833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14125-PA 156 GF14125-PA 1..156 1..156 757 91.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23963-PA 156 GG23963-PA 1..156 1..156 789 97.4 Plus
Dere\GG25089-PA 121 GG25089-PA 1..67 12..78 134 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13545-PA 157 GH13545-PA 1..157 1..156 568 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5676-PA 156 CG5676-PA 1..156 1..156 802 100 Plus
CG12511-PB 131 CG12511-PB 6..67 7..68 139 40.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19196-PA 157 GI19196-PA 1..156 1..155 533 63.5 Plus
Dmoj\GI17557-PA 126 GI17557-PA 11..110 12..117 134 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18968-PA 157 GL18968-PA 1..157 1..156 588 69.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19050-PA 157 GA19050-PA 1..156 1..155 584 69.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11901-PA 156 GM11901-PA 1..156 1..156 803 98.7 Plus
Dsec\GM18565-PA 121 GM18565-PA 1..57 12..68 135 43.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22288-PA 156 GD22288-PA 1..156 1..156 803 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17529-PA 157 GJ17529-PA 1..157 1..156 547 66.2 Plus
Dvir\GJ15573-PA 136 GJ15573-PA 11..120 12..117 148 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18998-PA 155 GK18998-PA 3..154 5..155 471 57.9 Plus
Dwil\GK19026-PA 135 GK19026-PA 4..71 3..72 146 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26263-PA 156 GE26263-PA 1..156 1..156 788 96.8 Plus