Clone RE46170 Report

Search the DGRC for RE46170

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:461
Well:70
Vector:pFlc-1
Associated Gene/TranscriptObp56a-RA
Protein status:RE46170.pep: gold
Sequenced Size:559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11797 2002-01-01 Sim4 clustering to Release 2
CG11797 2002-04-26 Blastp of sequenced clone
CG11797 2003-01-01 Sim4 clustering to Release 3
Obp56a 2008-04-29 Release 5.5 accounting
Obp56a 2008-08-15 Release 5.9 accounting
Obp56a 2008-12-18 5.12 accounting

Clone Sequence Records

RE46170.complete Sequence

559 bp (559 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113487

> RE46170.complete
ATCAGAACTTCCCCAACGTTCTAACAAGTCAAAGTATTTCTCAACATGAA
CTCCTACTTCGTGATCGCTTTGAGTGCTCTTTTTGTGACTCTGGCTGTTG
GATCGTCCCTTAATCTGAGCGACGAGCAGAAGGATCTGGCCAAGCAGCAT
CGTGAGCAGTGCGCCGAGGAAGTGAAACTTACCGAGGAGGAAAAGGCCAA
GGTCAATGCCAAGGACTTCAATAACCCCACCGAGAACATCAAGTGCTTTG
CCAACTGCTTCTTCGAGAAGGTCGGAACCCTGAAGGACGGTGAGCTGCAG
GAGTCAGTGGTGCTGGAGAAGCTCGGCGCTCTCATTGGCGAGGAGAAGAC
CAAGGCGGCTCTGGAGAAGTGCAGGACCATCAAGGGCGAGAACAAGTGTG
ATACCGCCTCCAAGTTGTACGATTGCTTCGAGAGCTTCAAGCCCGCCCCC
GAGGCTAAGGCCTAAAGAAGTTAGGGATTTAATGCTTGGCAAATTGTGAT
TCGGGAAAAAATGTAACAAAATTTAAATAAATTCTTTGTCCAACAAAAAA
AAAAAAAAA

RE46170.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-RA 786 Obp56a-RA 137..679 1..543 2715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15585287..15585725 105..543 2195 100 Plus
chr2R 21145070 chr2R 15584944..15585048 1..105 525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19698068..19698506 105..543 2195 100 Plus
2R 25286936 2R 19697725..19697829 1..105 525 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19699267..19699705 105..543 2195 100 Plus
2R 25260384 2R 19698924..19699028 1..105 525 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:24:01 has no hits.

RE46170.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:24:44 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15584944..15585048 1..105 100 -> Plus
chr2R 15585288..15585725 106..544 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:37 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 46..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:58 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 46..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:20:28 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 46..465 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:19 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 46..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:15 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 46..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:21 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 3..545 1..544 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:58 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 3..545 1..544 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:20:28 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 3..545 1..544 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:19 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 3..545 1..544 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:15 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 3..545 1..544 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:44 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19697725..19697829 1..105 100 -> Plus
2R 19698069..19698506 106..544 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:44 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19697725..19697829 1..105 100 -> Plus
2R 19698069..19698506 106..544 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:44 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19697725..19697829 1..105 100 -> Plus
2R 19698069..19698506 106..544 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:20:28 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15585230..15585334 1..105 100 -> Plus
arm_2R 15585574..15586011 106..544 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:09 Download gff for RE46170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19699268..19699705 106..544 99   Plus
2R 19698924..19699028 1..105 100 -> Plus

RE46170.hyp Sequence

Translation from 45 to 464

> RE46170.hyp
MNSYFVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEK
AKVNAKDFNNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEE
KTKAALEKCRTIKGENKCDTASKLYDCFESFKPAPEAKA*

RE46170.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-PA 139 CG11797-PA 1..139 1..139 711 100 Plus
Obp56d-PB 131 CG11218-PB 3..124 5..128 265 42.7 Plus
Obp56d-PA 131 CG11218-PA 3..124 5..128 265 42.7 Plus
Obp56e-PA 132 CG8462-PA 1..125 1..128 245 37.5 Plus
Obp56e-PB 131 CG8462-PB 1..124 1..128 234 36.7 Plus

RE46170.pep Sequence

Translation from 45 to 464

> RE46170.pep
MNSYFVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEK
AKVNAKDFNNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEE
KTKAALEKCRTIKGENKCDTASKLYDCFESFKPAPEAKA*

RE46170.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11734-PA 136 GF11734-PA 1..133 1..133 543 80.5 Plus
Dana\GF13167-PA 131 GF13167-PA 3..124 5..128 275 44.4 Plus
Dana\GF11735-PA 130 GF11735-PA 3..123 6..128 241 39 Plus
Dana\GF12521-PA 158 GF12521-PA 21..141 13..134 168 32.5 Plus
Dana\GF11738-PA 133 GF11738-PA 23..130 33..135 136 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21994-PA 139 GG21994-PA 1..139 1..139 656 89.9 Plus
Dere\GG20889-PA 131 GG20889-PA 4..124 9..128 262 44.6 Plus
Dere\GG21996-PA 132 GG21996-PA 20..125 23..128 226 41.5 Plus
Dere\GG20161-PA 153 GG20161-PA 21..146 13..139 146 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23015-PA 138 GH23015-PA 1..132 1..132 480 68.9 Plus
Dgri\GH23016-PA 135 GH23016-PA 1..130 1..132 319 48.5 Plus
Dgri\GH22760-PA 132 GH22760-PA 3..127 5..130 247 43.7 Plus
Dgri\GH23017-PA 132 GH23017-PA 3..125 5..129 208 32.8 Plus
Dgri\GH23020-PA 135 GH23020-PA 26..129 34..132 147 35.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-PA 139 CG11797-PA 1..139 1..139 711 100 Plus
Obp56d-PB 131 CG11218-PB 3..124 5..128 265 42.7 Plus
Obp56d-PA 131 CG11218-PA 3..124 5..128 265 42.7 Plus
Obp56e-PA 132 CG8462-PA 1..125 1..128 245 37.5 Plus
Obp56e-PB 131 CG8462-PB 1..124 1..128 234 36.7 Plus
Obp47a-PA 165 CG12944-PA 21..139 13..132 167 27.9 Plus
Obp47a-PB 160 CG12944-PB 1..134 1..132 165 27.7 Plus
Obp56h-PB 134 CG13874-PB 8..131 16..135 141 28 Plus
Obp56h-PA 134 CG13874-PA 8..131 16..135 141 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21082-PA 138 GI21082-PA 1..134 1..134 513 72.4 Plus
Dmoj\GI18537-PA 132 GI18537-PA 3..125 5..128 280 46.8 Plus
Dmoj\GI21083-PA 130 GI21083-PA 4..123 9..128 221 35 Plus
Dmoj\GI19754-PA 160 GI19754-PA 29..135 24..132 150 26.6 Plus
Dmoj\GI21087-PA 135 GI21087-PA 25..129 33..132 144 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10358-PA 137 GL10358-PA 1..137 1..137 555 78.1 Plus
Dper\GL11722-PA 131 GL11722-PA 3..125 5..129 264 45.6 Plus
Dper\GL10359-PA 130 GL10359-PA 17..123 22..128 217 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp56a-PA 137 GA11204-PA 1..137 1..137 552 77.4 Plus
Dpse\Obp56d-PA 131 GA10849-PA 3..125 5..129 264 45.6 Plus
Dpse\Obp56e-PA 130 GA21096-PA 17..123 22..128 216 39.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21981-PA 139 GM21981-PA 1..139 1..139 666 92.8 Plus
Dsec\GM23170-PA 131 GM23170-PA 3..124 5..128 257 42.7 Plus
Dsec\Obp56e-PA 119 GM23181-PA 20..112 23..128 190 38.7 Plus
Dsec\GM21250-PA 165 GM21250-PA 13..132 6..125 146 26.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56a-PA 139 GD11477-PA 1..139 1..139 665 92.1 Plus
Dsim\Obp56d-PA 131 GD15213-PA 3..124 5..128 256 42.7 Plus
Dsim\Obp56e-PA 132 GD11478-PA 20..125 23..128 219 39.6 Plus
Dsim\Obp47a-PA 165 GD10765-PA 13..132 6..125 144 27.2 Plus
Dsim\Obp56h-PA 134 GD11481-PA 4..131 3..135 135 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp56a-PA 138 GJ20931-PA 1..133 1..133 495 72.2 Plus
Dvir\Obp56d-PA 132 GJ21407-PA 3..125 5..128 262 46.8 Plus
Dvir\Obp56eL1-PA 130 GJ20932-PA 3..130 5..135 254 38.9 Plus
Dvir\Obp56h-PA 135 GJ20934-PA 25..129 33..132 165 38.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15889-PA 139 GK15889-PA 1..139 1..139 518 72.7 Plus
Dwil\GK15691-PA 132 GK15691-PA 3..127 4..130 253 38.6 Plus
Dwil\GK15692-PA 132 GK15692-PA 19..125 22..128 245 43.9 Plus
Dwil\GK15892-PA 137 GK15892-PA 26..132 34..135 143 30.8 Plus
Dwil\GK20947-PA 167 GK20947-PA 25..137 12..132 135 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12074-PA 139 GE12074-PA 1..139 1..139 631 87.1 Plus
Dyak\GE13830-PA 131 GE13830-PA 3..124 5..128 271 47.2 Plus
Dyak\Obp56e-PA 132 GE12075-PA 3..125 6..128 244 39 Plus
Dyak\GE12851-PA 163 GE12851-PA 13..132 6..125 152 28.5 Plus
Dyak\GE12081-PA 134 GE12081-PA 4..131 3..135 138 28.3 Plus