Clone RE46223 Report

Search the DGRC for RE46223

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:462
Well:23
Vector:pFlc-1
Associated Gene/Transcriptgus-RI
Protein status:RE46223.pep: gold
Sequenced Size:1390

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
gus-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE46223.complete Sequence

1390 bp assembled on 2009-08-05

GenBank Submission: BT089043.1

> RE46223.complete
AAAGGTTCCTGAGTGATATTTTGCTTTATGTGTTGTTTTATTTTAATCAT
AGCAAATCGACAAGATAAAAGTAATGTATAAGGGTGGTCGGACACCTTCT
ATTAGGTCCAGTGAAAGGCGTCGTCCTCAAAGTGTTTCATCTATATCCAC
ACTATCCCCGAGAGTTGTTTTGTCCAGATTGGAGCCGAGGGAGTTTGAAC
GTCTTCGACTATCCTACAAAATTGCAATCGACCAAAGAAGATCCAGAAGC
TGCCGTGGCATGAACATGGGTCAAAAAATTAGTGGCGGAGTCAAAACAGT
TAGTCGCAATGATTCACAGTCTACATTTAAACCAATAATACCAAGAGAGT
TGCAAGCTGATTTCGTTAAACCAGCGCGAATCGATATATTACTTGATATG
CCGCCAGCATCTCGAGATCTTCAATTGAAGCATTCATGGAACTCCGAAGA
TCGGTCTCTTAACATTTTTGTAAAAGAGGACGACAAGTTGACATTTCATA
GGCACCCAGTGGCTCAAAGTACTGACTGTATTCGCGGAAAAGTCGGACTT
ACAAAGGGATTGCATATTTGGGAAATTTATTGGCCAACAAGGCAAAGAGG
AACCCACGCTGTTGTTGGCGTATGCACTGCAGATGCACCTTTACATTCAG
TTGGCTACCAAAGTTTAGTTGGATCAACTGAACAAAGTTGGGGCTGGGAC
TTAGGAAGAAATAAATTATACCATGACTCAAAAAACTGCGCTGGAGTGAC
ATATCCAGCAATTCTTAAAAACGACGAAGCTTTTTTAGTTCCAGATAAGT
TCTTAGTAGCGTTAGATATGGACGAAGGAACACTAAGCTTCATTGTTGAT
CAGCAGTACCTCGGTATTGCGTTTAGAGGACTGCGAGGGAAAAAACTATA
TCCAATTGTTTCGGCGGTCTGGGGACACTGTGAAATAACAATGCGTTACA
TTGGTGGATTAGATCCCGAACCCTTGCCCCTAATGGATCTTTGCCGAAGA
ACAATTCGTCAAAAAATTGGTCGCACAAACTTGGAGGAGCACATTCAACA
GCTTCAACTTCCTTTATCAATGAAAACATATTTATTGTATAAAAACCGTA
GATAATAGTTTTGTTAAGTAGATGGAGGAGCAATTTCAATTTTTGCTGCA
TGTGATGAAAGCAGCAAATACTAATTGTGTTAGATTATAATAGTATTAGA
TCAATGTTTGTCTGTCCTCCAACAGGAAAATCATAGGTATACAATTCGTA
ATAATACTTTACTTAAGCTATAAAGATTGATTGTATATTAAGAAGCATTC
AAATAATAGTATGTACACGGAATGACATCTCATCTTGCAATAAATTGGAG
AATCGAGTTTCTTCATGTAACATTAAAAAAAAAAAAAAAA

RE46223.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
gus.f 2004 gus.f 212..1586 1..1375 6875 100 Plus
gus.a 1816 gus.a 332..1633 74..1375 6510 100 Plus
gus.h 1976 gus.h 332..1633 74..1375 6510 100 Plus
gus.a 1816 gus.a 31..108 1..78 390 100 Plus
gus.h 1976 gus.h 31..108 1..78 390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1008241..1009134 965..72 4425 99.7 Minus
chr2R 21145070 chr2R 1004883..1005291 1374..966 2030 99.8 Minus
chr2R 21145070 chr2R 1015689..1015766 78..1 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5120763..5121656 965..72 4455 99.9 Minus
2R 25286936 2R 5117393..5117802 1375..966 2050 100 Minus
2R 25286936 2R 5128223..5128300 78..1 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5121962..5122855 965..72 4455 99.8 Minus
2R 25260384 2R 5118592..5119001 1375..966 2050 100 Minus
2R 25260384 2R 5129422..5129499 78..1 390 100 Minus
Blast to na_te.dros performed 2019-03-16 04:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 278..388 1238..1342 124 63.1 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 7526..7636 1238..1342 124 63.1 Plus

RE46223.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:08:40 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1004883..1005291 966..1374 99 <- Minus
chr2R 1008241..1009130 76..965 99 <- Minus
chr2R 1015692..1015766 1..75 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:10:51 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RB 1..1032 74..1105 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:44 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RB 1..1032 74..1105 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:57 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RK 1..840 266..1105 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:00 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RK 1..840 266..1105 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:10:51 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RB 13..1386 1..1374 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:43 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RB 13..1386 1..1374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:57 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RH 22..1395 1..1374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:00 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RH 22..1395 1..1374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:40 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5128226..5128300 1..75 100   Minus
2R 5117394..5117802 966..1374 100 <- Minus
2R 5120763..5121652 76..965 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:40 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5128226..5128300 1..75 100   Minus
2R 5117394..5117802 966..1374 100 <- Minus
2R 5120763..5121652 76..965 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:40 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5128226..5128300 1..75 100   Minus
2R 5117394..5117802 966..1374 100 <- Minus
2R 5120763..5121652 76..965 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:57 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1004899..1005307 966..1374 100 <- Minus
arm_2R 1008268..1009157 76..965 100 <- Minus
arm_2R 1015731..1015805 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:15 Download gff for RE46223.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5118593..5119001 966..1374 100 <- Minus
2R 5121962..5122851 76..965 100 <- Minus
2R 5129425..5129499 1..75 100   Minus

RE46223.hyp Sequence

Translation from 73 to 1104

> RE46223.hyp
MYKGGRTPSIRSSERRRPQSVSSISTLSPRVVLSRLEPREFERLRLSYKI
AIDQRRSRSCRGMNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKP
ARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVAQST
DCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQSLVG
STEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMD
EGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEP
LPLMDLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYLLYKNRR*

RE46223.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
gus-PM 279 CG2944-PM 1..279 65..343 1486 100 Plus
gus-PL 279 CG2944-PL 1..279 65..343 1486 100 Plus
gus-PK 279 CG2944-PK 1..279 65..343 1486 100 Plus
gus-PJ 279 CG2944-PJ 1..279 65..343 1486 100 Plus
gus-PI 279 CG2944-PI 1..279 65..343 1486 100 Plus

RE46223.pep Sequence

Translation from 73 to 1104

> RE46223.pep
MYKGGRTPSIRSSERRRPQSVSSISTLSPRVVLSRLEPREFERLRLSYKI
AIDQRRSRSCRGMNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKP
ARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVAQST
DCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQSLVG
STEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMD
EGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEP
LPLMDLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYLLYKNRR*

RE46223.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12960-PA 255 GF12960-PA 81..250 120..294 388 45.7 Plus
Dana\GF15713-PA 304 GF15713-PA 74..279 121..337 229 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23140-PA 349 GG23140-PA 8..349 2..343 1817 99.1 Plus
Dere\GG22511-PA 255 GG22511-PA 81..250 120..294 387 45.7 Plus
Dere\GG25044-PA 301 GG25044-PA 56..271 111..337 240 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13013-PA 349 GH13013-PA 8..349 2..343 1726 92.4 Plus
Dgri\GH21169-PA 252 GH21169-PA 78..247 120..294 395 46.9 Plus
Dgri\GH11484-PA 283 GH11484-PA 36..256 106..337 231 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
gus-PM 279 CG2944-PM 1..279 65..343 1486 100 Plus
gus-PL 279 CG2944-PL 1..279 65..343 1486 100 Plus
gus-PK 279 CG2944-PK 1..279 65..343 1486 100 Plus
gus-PJ 279 CG2944-PJ 1..279 65..343 1486 100 Plus
gus-PI 279 CG2944-PI 1..279 65..343 1486 100 Plus
gus-PH 279 CG2944-PH 1..279 65..343 1486 100 Plus
gus-PG 279 CG2944-PG 1..279 65..343 1486 100 Plus
Fsn-PA 255 CG4643-PA 81..250 120..294 394 45.7 Plus
Fsn-PB 255 CG4643-PB 81..250 120..294 394 45.7 Plus
SP555-PD 293 CG14041-PD 19..271 50..337 238 28.2 Plus
SP555-PB 293 CG14041-PB 19..271 50..337 238 28.2 Plus
SP555-PC 301 CG14041-PC 19..271 50..337 238 28.2 Plus
SP555-PA 301 CG14041-PA 19..271 50..337 238 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18267-PA 349 GI18267-PA 8..349 2..343 1730 92.7 Plus
Dmoj\GI18764-PA 252 GI18764-PA 78..247 120..294 396 46.3 Plus
Dmoj\GI16979-PA 316 GI16979-PA 85..290 121..337 209 27.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15433-PA 349 GL15433-PA 8..349 2..343 1777 96.2 Plus
Dper\GL10506-PA 255 GL10506-PA 81..250 120..294 393 46.9 Plus
Dper\GL26545-PA 292 GL26545-PA 51..270 113..337 227 28.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23998-PA 349 GA23998-PA 8..349 2..343 1777 96.2 Plus
Dpse\GA18323-PA 255 GA18323-PA 81..250 120..294 393 46.9 Plus
Dpse\GA12721-PA 292 GA12721-PA 51..270 113..337 227 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26734-PA 349 GM26734-PA 8..349 2..343 1827 100 Plus
Dsec\GM20297-PA 255 GM20297-PA 62..250 102..294 389 43.3 Plus
Dsec\GM18519-PA 301 GM18519-PA 56..271 111..337 239 28.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16681-PA 349 GD16681-PA 8..349 2..343 1827 100 Plus
Dsim\GD25778-PA 245 GD25778-PA 81..240 120..294 331 41.7 Plus
Dsim\GD12021-PA 301 GD12021-PA 56..271 111..337 240 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21895-PA 349 GJ21895-PA 8..349 2..343 1731 92.4 Plus
Dvir\GJ21788-PA 252 GJ21788-PA 78..247 120..294 393 46.3 Plus
Dvir\GJ17226-PA 299 GJ17226-PA 53..272 107..337 226 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14868-PA 349 GK14868-PA 8..349 2..343 1756 94.7 Plus
Dwil\GK22006-PA 255 GK22006-PA 81..250 120..294 389 46.3 Plus
Dwil\GK24858-PA 301 GK24858-PA 64..276 111..337 219 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\gus-PA 349 GE11348-PA 8..349 2..343 1814 98.8 Plus
Dyak\GE13381-PA 255 GE13381-PA 81..250 120..294 381 45.1 Plus
Dyak\GE11313-PA 303 GE11313-PA 58..273 111..337 235 28.3 Plus