Clone RE46349 Report

Search the DGRC for RE46349

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:463
Well:49
Vector:pFlc-1
Associated Gene/TranscriptTina-1-RA
Protein status:RE46349.pep: gold
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2803 2004-01-14 Blastp of sequenced clone
Tina-1 2008-04-29 Release 5.5 accounting
Tina-1 2008-08-15 Release 5.9 accounting
Tina-1 2008-12-18 5.12 accounting

Clone Sequence Records

RE46349.complete Sequence

926 bp (926 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011448

> RE46349.complete
AGTTGGAGTTTTGCTGGCCATCGGCGCGGTTGTATCTCTGCTGGAGCTCG
TGCACACTATCCTATCCAATCCCGAAGAGCTCTCTCGCCTTTGCTTAGTG
CAGCAATTTGCAATTTTAATTATCTGCAGGCGGTTCGACAAGAAAATGGG
CCAAGCAAAGAAAGTCTCCTCCGCCTTGAGCAAGCTCTTCGTGTACGGCG
CCCTCAAGTACGGACAGCCCAGCAACTCAATCCTGGCCAGCTCTGGCAAC
GGCTTCGCTAAGTTCTGGTGCAAGGCGACCACCACCCAAAAGCTGCCGCT
AGTGATCGCCACCCGCTACAACATTCCCTTCCTGCTGAACAAGCCCGGAG
TGGGATATTACGTAACAGGGGAGATCTACGAGGTGGACGATCGAATGCTG
AATTCCCTGGACAACCTGGAGGATTGCGAGGAGATCTACACTCGCGAGAT
GCACGATATGAACATTGGCGTTGGAGAAGGAACCGTTCCATGCTGGGTGT
ACCTGCTGCAGAAGTACCCGGAGAACCTACTTAGTCTGCGCTACTTGTCC
AGCTACGAGAACTCAACCACCCATCCATACATTATGCGCCATCGCCGCAC
CCACAAGCATCCGGCCCAGGACGACCTCACCTACGAGGCCCAGAACTAAT
AACGTGGGTTGTGGTGTCGCCCGTTTGTTTGGATGTTCTCTGGATAGCCT
GGCCACTAATCTTATGTTACCGTAGTTGCATTTTAAGACCGTACTTGCAG
ACGCAGATGTACTGATCGATATATACCCGTATATATGGGCAAACGATATA
AACTGATACATATGTACCATACGCATTATTTAGGTTTTAGCAAACGTAGT
CTGTAATTTGATAGTTTTCGACAAACAAAGCAAATAAACTGAAGCAATTT
AAAATAAAACAAAAAAAAAAAAAAAA

RE46349.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tina-1-RA 1044 Tina-1-RA 90..1003 1..914 4555 99.8 Plus
Tina-1.a 1759 Tina-1.a 963..1718 159..914 3765 99.8 Plus
Tina-1-RB 1607 Tina-1-RB 811..1566 159..914 3765 99.8 Plus
Tina-1.a 1759 Tina-1.a 1..156 5..160 780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20826580..20827009 909..480 2120 99.5 Minus
chr2R 21145070 chr2R 20827076..20827397 480..159 1610 100 Minus
chr2R 21145070 chr2R 20828204..20828363 160..1 785 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24940621..24941055 914..480 2160 99.8 Minus
2R 25286936 2R 24941122..24941443 480..159 1610 100 Minus
2R 25286936 2R 24942250..24942409 160..1 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24941820..24942254 914..480 2160 99.7 Minus
2R 25260384 2R 24942321..24942642 480..159 1610 100 Minus
2R 25260384 2R 24943449..24943608 160..1 800 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:37:41 has no hits.

RE46349.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:30 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20826579..20827008 481..910 99 <- Minus
chr2R 20827076..20827395 161..480 100 <- Minus
chr2R 20828204..20828363 1..160 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:41 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..504 146..649 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:45 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..504 146..649 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:05:52 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..504 146..649 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:35 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..504 146..649 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:51 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..504 146..649 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:51:11 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..909 1..910 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:45 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..909 1..910 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:05:52 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 5..913 1..910 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:35 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 1..909 1..910 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:51 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
Tina-1-RA 5..913 1..910 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:30 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24940625..24941054 481..910 99 <- Minus
2R 24941122..24941441 161..480 100 <- Minus
2R 24942250..24942409 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:30 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24940625..24941054 481..910 99 <- Minus
2R 24941122..24941441 161..480 100 <- Minus
2R 24942250..24942409 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:30 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24940625..24941054 481..910 99 <- Minus
2R 24941122..24941441 161..480 100 <- Minus
2R 24942250..24942409 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:05:52 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20828148..20828577 481..910 99 <- Minus
arm_2R 20828645..20828964 161..480 100 <- Minus
arm_2R 20829773..20829932 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:05 Download gff for RE46349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24941842..24942271 481..910 99 <- Minus
2R 24942339..24942658 161..480 100 <- Minus
2R 24943467..24943626 1..160 100   Minus

RE46349.hyp Sequence

Translation from 0 to 648

> RE46349.hyp
VGVLLAIGAVVSLLELVHTILSNPEELSRLCLVQQFAILIICRRFDKKMG
QAKKVSSALSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPL
VIATRYNIPFLLNKPGVGYYVTGEIYEVDDRMLNSLDNLEDCEEIYTREM
HDMNIGVGEGTVPCWVYLLQKYPENLLSLRYLSSYENSTTHPYIMRHRRT
HKHPAQDDLTYEAQN*

RE46349.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Tina-1-PA 167 CG2803-PA 1..167 49..215 893 100 Plus
Tina-1-PB 84 CG2803-PB 1..84 132..215 462 100 Plus
CG2811-PA 157 CG2811-PA 2..157 52..211 336 43.8 Plus
CG2811-PB 157 CG2811-PB 2..141 52..193 320 44.4 Plus
CG2811-PC 151 CG2811-PC 3..135 60..193 319 44.8 Plus

RE46349.pep Sequence

Translation from 145 to 648

> RE46349.pep
MGQAKKVSSALSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKL
PLVIATRYNIPFLLNKPGVGYYVTGEIYEVDDRMLNSLDNLEDCEEIYTR
EMHDMNIGVGEGTVPCWVYLLQKYPENLLSLRYLSSYENSTTHPYIMRHR
RTHKHPAQDDLTYEAQN*

RE46349.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11524-PA 167 GF11524-PA 1..167 1..167 836 92.2 Plus
Dana\GF11525-PA 153 GF11525-PA 2..153 9..163 371 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19875-PA 167 GG19875-PA 1..167 1..167 900 99.4 Plus
Dere\GG19876-PA 157 GG19876-PA 1..141 1..145 323 43.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22048-PA 167 GH22048-PA 2..167 5..167 764 83.1 Plus
Dgri\GH22049-PA 156 GH22049-PA 4..156 10..163 370 48.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tina-1-PA 167 CG2803-PA 1..167 1..167 893 100 Plus
Tina-1-PB 84 CG2803-PB 1..84 84..167 462 100 Plus
CG2811-PA 157 CG2811-PA 2..157 4..163 336 43.8 Plus
CG2811-PB 157 CG2811-PB 2..141 4..145 320 44.4 Plus
CG2811-PC 151 CG2811-PC 3..135 12..145 319 44.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19134-PA 168 GI19134-PA 1..165 1..165 824 89.7 Plus
Dmoj\GI19135-PA 156 GI19135-PA 1..156 7..163 390 49 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10895-PA 167 GL10895-PA 1..167 1..167 848 91.6 Plus
Dper\GL10896-PA 153 GL10896-PA 3..153 12..163 337 44.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15466-PA 167 GA15466-PA 1..167 1..167 848 91.6 Plus
Dpse\GA15469-PA 153 GA15469-PA 3..153 12..163 351 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11776-PA 167 GM11776-PA 1..167 1..167 902 99.4 Plus
Dsec\GM11777-PA 157 GM11777-PA 2..141 4..145 324 44.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24906-PA 167 GD24906-PA 1..167 1..167 904 100 Plus
Dsim\GD24907-PA 157 GD24907-PA 2..141 4..145 322 44.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22267-PA 168 GJ22267-PA 1..168 1..167 825 90.5 Plus
Dvir\GJ22268-PA 156 GJ22268-PA 1..156 7..163 366 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20729-PA 168 GK20729-PA 1..165 1..165 835 93.3 Plus
Dwil\GK20731-PA 157 GK20731-PA 3..149 4..153 340 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11399-PA 167 GE11399-PA 1..167 1..167 897 99.4 Plus
Dyak\GE11400-PA 157 GE11400-PA 2..157 4..163 329 43.1 Plus