Clone RE46560 Report

Search the DGRC for RE46560

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:465
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG1983-RA
Protein status:RE46560.pep: gold
Preliminary Size:794
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1983 2002-01-01 Sim4 clustering to Release 2
CG1983 2003-01-01 Sim4 clustering to Release 3
CG1983 2003-01-22 Blastp of sequenced clone
CG1983 2008-04-29 Release 5.5 accounting
CG1983 2008-08-15 Release 5.9 accounting
CG1983 2008-12-18 5.12 accounting

Clone Sequence Records

RE46560.complete Sequence

1129 bp (1129 high quality bases) assembled on 2003-01-22

GenBank Submission: BT003497

> RE46560.complete
AGGTTTTGTTTTTATTTTTGCAAGGGCTGTTTCTTATCATTGAGTTAACC
AATTTTAAATGCTAAGACGCACAATGGCGGAATTCGACGTCAAAGCCGGC
CTGCAGCACGTGTTGAAGCGCATAGACGAGGTGCTCCTCCAGCGGCCCAA
AGAAGTTCAAGCTGCCAGGCCGCTGCTCGTTGCTGTAAGCAAAACAAAGC
CAGCGGAGGCCGTAATCGAGGCTTACGAGGGCGGACAAAGAGACTTCGGT
GAGAACTATGTACAGGAGCTGGAGGAGAAGAGCCGCCACCCGGACATTCT
GGCCAAGTGCCCCGACATCAGGTGGCACTTCATAGGCCACATGCAAAGCA
ACAAGATCAACAAGATCCTTTCTGTGCCAAATCTGCATATGATCCAGACC
GTAGATAGCGAGAAGTTGGCCACCAAACTGGACGCAGCCTGGTCTAAGCG
ACAGCCCACCCCTGAGGAGCCATTGCAGGTGCTCATCCAGATCAACACTA
GTGGTGAAGACGTTAAAAGCGGAATAGAGGCGAAAGATGCTCCTGCACTC
TACCAGTACATCAAGAGCAACCTTAAACACCTCAACCTGATGGGCATAAT
GACCATTGGTGCATTTGGTTTTGACTACAGCAATGGACCCAATCCGGATT
TCGTGTCCCTAATGCAGGTGCACAGATCCATATGTGAGGCGCACTCCTTG
GCCCCGGACTCGGTGCTCGTCTCCATGGGAATGTCCAACGACTTCGACAA
GGCGATCGAAATGGGCAGCACAGTGGTGCGCGTTGGCTCTTCTATTTTCG
GCCATCGGGCGGCCAAGGTGTAAGAAGGGGAGCGGAGCAGAGATGTGATA
GGAATGCGTTGCGGGCACTGAATACAGCCGATTCCCAATGACGTCCGACC
TCACGACTGAGCACCTCCAAGTTCGCTCATGTATCAGGTGGAACTGGGTA
TATTCACACAGACTAACGTAGTAAATCAGCAAATCAAAGATGATTTGGCG
TTTAAATTTAGAAACCCTTGAGATAAACAAATGTTATGTGTAGGCTGTTA
TTTGCCTTATTTAATTGTTAACCCTTTATAAACAATGCTTCCAAAGTGTC
AAAACCATTAAAAGAAAAAAAAAAAAAAA

RE46560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG1983-RA 1270 CG1983-RA 36..1146 1..1111 5555 100 Plus
CG1983.a 1697 CG1983.a 36..1146 1..1111 5555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25998691..25999048 1111..754 1685 98 Minus
chr3R 27901430 chr3R 25999105..25999347 754..512 1140 97.9 Minus
chr3R 27901430 chr3R 25999639..25999851 364..152 1020 98.6 Minus
chr3R 27901430 chr3R 25999406..25999555 512..363 750 100 Minus
chr2RHet 3288813 chr2RHet 826455..826577 512..634 510 94.3 Plus
chr3R 27901430 chr3R 25999915..26000012 152..55 475 99 Minus
chr3R 27901430 chr3R 26000083..26000134 52..1 260 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30176229..30176586 1111..754 1790 100 Minus
3R 32079331 3R 30176643..30176885 754..512 1215 100 Minus
3R 32079331 3R 30177177..30177389 364..152 1065 100 Minus
3R 32079331 3R 30176944..30177093 512..363 750 100 Minus
2R 25286936 2R 2083319..2083441 512..634 510 94.3 Plus
3R 32079331 3R 30177453..30177550 152..55 490 100 Minus
3R 32079331 3R 30177615..30177672 58..1 275 98.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29917060..29917417 1111..754 1790 100 Minus
3R 31820162 3R 29917474..29917716 754..512 1215 100 Minus
3R 31820162 3R 29918008..29918220 364..152 1065 100 Minus
3R 31820162 3R 29917775..29917924 512..363 750 100 Minus
2R 25260384 2R 2083319..2083441 512..634 510 94.3 Plus
3R 31820162 3R 29918284..29918381 152..55 490 100 Minus
3R 31820162 3R 29918446..29918503 58..1 275 98.2 Minus
2R 25260384 2R 2083234..2083261 485..512 140 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:15:04 has no hits.

RE46560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:16:13 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25998688..25999047 755..1114 97 <- Minus
chr3R 25999105..25999346 513..754 97 <- Minus
chr3R 25999406..25999553 365..512 100 <- Minus
chr3R 25999639..25999851 152..364 98 <- Minus
chr3R 25999916..26000012 55..151 98 <- Minus
chr3R 26000081..26000134 1..54 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:47 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:00 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:34 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:04 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:11:35 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:08:46 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..1113 1..1113 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:00 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..1113 1..1113 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:34 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RB 29..1141 1..1114 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:05 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RA 1..1113 1..1113 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:35 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1983-RB 29..1141 1..1114 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:13 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30176226..30176585 755..1114 99 <- Minus
3R 30176643..30176884 513..754 100 <- Minus
3R 30176944..30177091 365..512 100 <- Minus
3R 30177177..30177389 152..364 100 <- Minus
3R 30177454..30177550 55..151 100 <- Minus
3R 30177619..30177672 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:13 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30176226..30176585 755..1114 99 <- Minus
3R 30176643..30176884 513..754 100 <- Minus
3R 30176944..30177091 365..512 100 <- Minus
3R 30177177..30177389 152..364 100 <- Minus
3R 30177454..30177550 55..151 100 <- Minus
3R 30177619..30177672 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:13 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30176226..30176585 755..1114 99 <- Minus
3R 30176643..30176884 513..754 100 <- Minus
3R 30176944..30177091 365..512 100 <- Minus
3R 30177177..30177389 152..364 100 <- Minus
3R 30177454..30177550 55..151 100 <- Minus
3R 30177619..30177672 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:34 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26001948..26002307 755..1114 99 <- Minus
arm_3R 26002365..26002606 513..754 100 <- Minus
arm_3R 26002666..26002813 365..512 100 <- Minus
arm_3R 26002899..26003111 152..364 100 <- Minus
arm_3R 26003176..26003272 55..151 100 <- Minus
arm_3R 26003341..26003394 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:02 Download gff for RE46560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29917057..29917416 755..1114 99 <- Minus
3R 29917474..29917715 513..754 100 <- Minus
3R 29917775..29917922 365..512 100 <- Minus
3R 29918008..29918220 152..364 100 <- Minus
3R 29918285..29918381 55..151 100 <- Minus
3R 29918450..29918503 1..54 100   Minus

RE46560.hyp Sequence

Translation from 58 to 822

> RE46560.hyp
MLRRTMAEFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAE
AVIEAYEGGQRDFGENYVQELEEKSRHPDILAKCPDIRWHFIGHMQSNKI
NKILSVPNLHMIQTVDSEKLATKLDAAWSKRQPTPEEPLQVLIQINTSGE
DVKSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYSNGPNPDFVS
LMQVHRSICEAHSLAPDSVLVSMGMSNDFDKAIEMGSTVVRVGSSIFGHR
AAKV*

RE46560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG1983-PB 254 CG1983-PB 1..254 1..254 1301 100 Plus
CG1983-PA 254 CG1983-PA 1..254 1..254 1301 100 Plus

RE46560.pep Sequence

Translation from 58 to 822

> RE46560.pep
MLRRTMAEFDVKAGLQHVLKRIDEVLLQRPKEVQAARPLLVAVSKTKPAE
AVIEAYEGGQRDFGENYVQELEEKSRHPDILAKCPDIRWHFIGHMQSNKI
NKILSVPNLHMIQTVDSEKLATKLDAAWSKRQPTPEEPLQVLIQINTSGE
DVKSGIEAKDAPALYQYIKSNLKHLNLMGIMTIGAFGFDYSNGPNPDFVS
LMQVHRSICEAHSLAPDSVLVSMGMSNDFDKAIEMGSTVVRVGSSIFGHR
AAKV*

RE46560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16195-PA 249 GF16195-PA 1..248 6..253 1152 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11955-PA 254 GG11955-PA 1..253 1..253 1314 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18384-PA 249 GH18384-PA 1..248 6..253 1038 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1983-PB 254 CG1983-PB 1..254 1..254 1301 100 Plus
CG1983-PA 254 CG1983-PA 1..254 1..254 1301 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23376-PA 255 GI23376-PA 1..250 1..250 1065 74.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14062-PA 254 GL14062-PA 1..253 1..253 1177 84.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26943-PA 254 GA26943-PA 1..253 1..253 1177 84.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12173-PA 254 GM12173-PA 1..253 1..253 1328 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17245-PA 270 GD17245-PA 1..253 1..253 1319 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10370-PA 254 GJ10370-PA 1..253 1..253 1087 75.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13144-PA 249 GK13144-PA 1..248 6..253 1117 81 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23404-PA 254 GE23404-PA 1..253 1..253 1317 96 Plus