Clone RE46718 Report

Search the DGRC for RE46718

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:467
Well:18
Vector:pFlc-1
Associated Gene/Transcriptveli-RA
Protein status:RE46718.pep: gold
Sequenced Size:908

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7662 2002-01-01 Sim4 clustering to Release 2
CG7662 2002-10-12 Blastp of sequenced clone
CG7662 2003-01-01 Sim4 clustering to Release 3
veli 2008-04-29 Release 5.5 accounting
veli 2008-08-15 Release 5.9 accounting
veli 2008-12-18 5.12 accounting

Clone Sequence Records

RE46718.complete Sequence

908 bp (908 high quality bases) assembled on 2002-10-12

GenBank Submission: BT011021

> RE46718.complete
ATATTATTTTCAGCTGCTCGAATAATATTTCAGGTCAGCTCAATTTGACT
GATTATTATTAAATTGAACAGCAATATGGCCGATAACGCAGAACCACTGA
CTTTGTCCAGAGATGTCAAAAGATCGATAGAGCTCTTGGAAAAGCTGCAA
GCGAGTGGCGACTTCCCCACGACAAAACTGGCCGCCCTGCAGAAGGTGCT
CAACTCGGACTTCATGACCTCCGTGCGGGAGGTGTACGAGCACGTCTACG
AGACGGTGGACATCCAGGGCTCCCACGACGTGAGGGCATCCGCCACTGCC
AAGGCCACTGTGGCAGCCTTCGCAGCCAGCGAGGGGCACGCTCATCCCAG
AGTCGTCGAGCTCCCGAAAACGGAGGAGGGCTTGGGTTTCAATGTAATGG
GGGGCAAGGAGCAAAACTCGCCCATCTATATATCCCGAATAATACCTGGA
GGCGTGGCTGACAGGCATGGTGGTCTGAAAAGGGGAGATCAACTTTTGTC
TGTGAATGGTGTGTCTGTCGAAGGAGAAAACCACGAGAAGGCCGTAGAGC
TATTAAAGCAAGCTGTCGGATCTGTAAAGCTGGTGGTACGCTACACACCA
AAGGTTCTCGAGGAAATGGAAATGCGATTTGATAAGCAACGCAACACACG
TCGTCGCCAATAAGGCACATCGGCAAAAACTTGTGCCATAGTAGTTTTTG
CCATTAGACCATGCTGATATGCACGTATCAAGCCCTTTACGAATAATATA
ATTTAACACAAATACCATTTATATATTATTTATTACAAAGAAACTCTGGA
AAATTACTCTTTAATCGTAAAAAGTGAGTGTTATGTATTTGTAACTAATT
ACCGCGTTGGTTTTTGTTCCAATAAATGTAATTAAAACTGTCAAAAAAAA
AAAAAAAA

RE46718.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
veli-RA 933 veli-RA 37..929 1..893 4465 100 Plus
veli-RC 1063 veli-RC 545..1059 379..893 2575 100 Plus
veli-RC 1063 veli-RC 14..393 1..380 1900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20887590..20887969 892..513 1900 100 Minus
chr3R 27901430 chr3R 20888319..20888588 380..111 1320 99.3 Minus
chr3R 27901430 chr3R 20888033..20888167 513..379 675 100 Minus
chr3R 27901430 chr3R 20888650..20888761 112..1 560 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25064417..25064797 893..513 1905 100 Minus
3R 32079331 3R 25065147..25065416 380..111 1350 100 Minus
3R 32079331 3R 25064861..25064995 513..379 675 100 Minus
3R 32079331 3R 25065478..25065589 112..1 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24805248..24805628 893..513 1905 100 Minus
3R 31820162 3R 24805978..24806247 380..111 1350 100 Minus
3R 31820162 3R 24805692..24805826 513..379 675 100 Minus
3R 31820162 3R 24806309..24806420 112..1 560 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:36:27 has no hits.

RE46718.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:37:29 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20887590..20887968 514..892 100 <- Minus
chr3R 20888033..20888166 380..513 100 <- Minus
chr3R 20888320..20888586 113..379 99 <- Minus
chr3R 20888650..20888761 1..112 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:18:55 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 1..588 76..663 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:51 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 1..588 76..663 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:58 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 1..588 76..663 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:45 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 1..588 76..663 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:09:24 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 1..588 76..663 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:51 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 7..898 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:51 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 7..898 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:58 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 3..894 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:45 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 8..899 1..892 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:09:24 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
veli-RA 3..894 1..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:29 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25064861..25064994 380..513 100 <- Minus
3R 25065148..25065414 113..379 100 <- Minus
3R 25065478..25065589 1..112 100   Minus
3R 25064418..25064796 514..892 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:29 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25064861..25064994 380..513 100 <- Minus
3R 25065148..25065414 113..379 100 <- Minus
3R 25065478..25065589 1..112 100   Minus
3R 25064418..25064796 514..892 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:29 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25064861..25064994 380..513 100 <- Minus
3R 25065148..25065414 113..379 100 <- Minus
3R 25065478..25065589 1..112 100   Minus
3R 25064418..25064796 514..892 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:58 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20890140..20890518 514..892 100 <- Minus
arm_3R 20890583..20890716 380..513 100 <- Minus
arm_3R 20890870..20891136 113..379 100 <- Minus
arm_3R 20891200..20891311 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:34:25 Download gff for RE46718.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24805249..24805627 514..892 100 <- Minus
3R 24805692..24805825 380..513 100 <- Minus
3R 24805979..24806245 113..379 100 <- Minus
3R 24806309..24806420 1..112 100   Minus

RE46718.hyp Sequence

Translation from 75 to 662

> RE46718.hyp
MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSV
REVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTE
EGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEG
ENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRRRQ*

RE46718.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
veli-PA 195 CG7662-PA 1..195 1..195 977 100 Plus
veli-PC 246 CG7662-PC 1..246 1..195 915 79.3 Plus
dlg1-PK 911 CG1725-PK 426..540 72..187 206 39.7 Plus
dlg1-PH 911 CG1725-PH 426..540 72..187 206 39.7 Plus
dlg1-PT 943 CG1725-PT 473..587 72..187 206 39.7 Plus

RE46718.pep Sequence

Translation from 75 to 662

> RE46718.pep
MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSV
REVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTE
EGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEG
ENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRRRQ*

RE46718.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17106-PA 195 GF17106-PA 1..195 1..195 1019 99 Plus
Dana\GF19077-PA 1005 GF19077-PA 487..580 91..185 203 46.3 Plus
Dana\GF21468-PA 542 GF21468-PA 57..148 91..171 157 39.8 Plus
Dana\GF16442-PA 1847 GF16442-PA 1234..1323 94..175 151 39.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12292-PA 195 GG12292-PA 1..195 1..195 1021 99.5 Plus
Dere\GG18414-PA 1004 GG18414-PA 467..579 72..185 200 40.4 Plus
Dere\GG18475-PA 537 GG18475-PA 52..143 91..171 157 39.8 Plus
Dere\GG11485-PA 1855 GG11485-PA 1235..1324 94..175 151 39.6 Plus
Dere\GG13200-PA 625 GG13200-PA 164..249 90..177 144 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22341-PA 195 GH22341-PA 1..195 1..195 898 94.4 Plus
Dgri\GH12185-PA 828 GH12185-PA 356..449 91..185 203 46.3 Plus
Dgri\GH24875-PA 499 GH24875-PA 14..105 91..171 157 39.8 Plus
Dgri\GH18723-PA 1864 GH18723-PA 1262..1351 94..175 151 39.6 Plus
Dgri\GH15089-PA 640 GH15089-PA 169..254 90..177 147 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
veli-PA 195 CG7662-PA 1..195 1..195 977 100 Plus
veli-PC 246 CG7662-PC 1..246 1..195 915 79.3 Plus
dlg1-PK 911 CG1725-PK 426..540 72..187 206 39.7 Plus
dlg1-PH 911 CG1725-PH 426..540 72..187 206 39.7 Plus
dlg1-PT 943 CG1725-PT 473..587 72..187 206 39.7 Plus
dlg1-PL 946 CG1725-PL 434..548 72..187 206 39.7 Plus
dlg1-PS 960 CG1725-PS 465..579 72..187 206 39.7 Plus
dlg1-PN 960 CG1725-PN 465..579 72..187 206 39.7 Plus
dlg1-PD 960 CG1725-PD 465..579 72..187 206 39.7 Plus
dlg1-PE 960 CG1725-PE 465..579 72..187 206 39.7 Plus
dlg1-PA 968 CG1725-PA 473..587 72..187 206 39.7 Plus
dlg1-PB 970 CG1725-PB 485..599 72..187 206 39.7 Plus
dlg1-PQ 975 CG1725-PQ 465..579 72..187 206 39.7 Plus
dlg1-PG 975 CG1725-PG 465..579 72..187 206 39.7 Plus
dlg1-PP 983 CG1725-PP 473..587 72..187 206 39.7 Plus
dlg1-PR 1001 CG1725-PR 465..579 72..187 206 39.7 Plus
dlg1-PM 1030 CG1725-PM 723..837 72..187 206 39.7 Plus
CG32758-PA 531 CG32758-PA 46..154 91..187 160 34.5 Plus
Magi-PC 1202 CG30388-PC 929..1009 94..172 153 34.6 Plus
Magi-PB 1202 CG30388-PB 929..1009 94..172 153 34.6 Plus
Magi-PA 1202 CG30388-PA 929..1009 94..172 153 34.6 Plus
scrib-PH 1939 CG43398-PH 1305..1417 73..175 149 32.7 Plus
scrib-PI 1711 CG43398-PI 1240..1329 94..175 148 35.6 Plus
scrib-PP 1729 CG43398-PP 1265..1354 94..175 148 35.6 Plus
scrib-PB 1756 CG43398-PB 1145..1234 94..175 148 35.6 Plus
scrib-PA 1756 CG43398-PA 1145..1234 94..175 148 35.6 Plus
scrib-PU 1766 CG43398-PU 1145..1234 94..175 148 35.6 Plus
scrib-PD 1851 CG43398-PD 1240..1329 94..175 148 35.6 Plus
scrib-PS 1859 CG43398-PS 514..603 94..175 148 35.6 Plus
scrib-PR 1951 CG43398-PR 1145..1234 94..175 148 35.6 Plus
scrib-PK 2331 CG43398-PK 1145..1234 94..175 148 35.6 Plus
scrib-PJ 2426 CG43398-PJ 1240..1329 94..175 148 35.6 Plus
scrib-PT 2444 CG43398-PT 1145..1234 94..175 148 35.6 Plus
scrib-PM 2490 CG43398-PM 1145..1234 94..175 148 35.6 Plus
scrib-PO 2515 CG43398-PO 1170..1259 94..175 148 35.6 Plus
scrib-PN 2554 CG43398-PN 1265..1354 94..175 148 35.6 Plus
scrib-PQ 2577 CG43398-PQ 1170..1259 94..175 148 35.6 Plus
scrib-PL 2585 CG43398-PL 1240..1329 94..175 148 35.6 Plus
Syn1-PE 624 CG7152-PE 163..248 90..177 147 37.5 Plus
Syn1-PC 625 CG7152-PC 164..249 90..177 147 37.5 Plus
Syn1-PD 627 CG7152-PD 164..249 90..177 147 37.5 Plus
Syn1-PB 627 CG7152-PB 164..249 90..177 147 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23978-PA 195 GI23978-PA 1..195 1..195 908 95.4 Plus
Dmoj\GI15716-PA 833 GI15716-PA 321..433 72..185 203 41.2 Plus
Dmoj\GI14707-PA 503 GI14707-PA 18..109 91..171 157 39.8 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 1255..1344 94..175 151 39.6 Plus
Dmoj\GI12519-PA 857 GI12519-PA 120..216 72..171 144 35 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21893-PA 195 GL21893-PA 1..195 1..195 1000 96.9 Plus
Dper\GL14855-PA 443 GL14855-PA 320..404 91..176 190 47.7 Plus
Dper\GL23097-PA 1247 GL23097-PA 904..1007 80..175 158 38.1 Plus
Dper\GL25270-PA 602 GL25270-PA 134..219 90..177 145 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20509-PA 195 GA20509-PA 1..195 1..195 1000 96.9 Plus
Dpse\GA17119-PA 514 GA17119-PA 29..120 91..171 156 39.8 Plus
Dpse\GA18897-PA 1889 GA18897-PA 1265..1379 89..192 156 36.2 Plus
Dpse\GA20140-PA 633 GA20140-PA 165..250 90..177 144 37.5 Plus
Dpse\GA23289-PA 72 GA23289-PA 1..59 102..161 142 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17757-PA 195 GM17757-PA 1..195 1..195 1024 100 Plus
Dsec\GM13076-PA 140 GM13076-PA 1..62 102..164 156 54 Plus
Dsec\GM10328-PA 1851 GM10328-PA 1237..1326 94..175 151 39.6 Plus
Dsec\GM15748-PA 1211 GM15748-PA 939..1019 94..172 145 34.6 Plus
Dsec\GM22110-PA 625 GM22110-PA 164..249 90..177 144 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18238-PA 212 GD18238-PA 1..185 1..185 964 99.5 Plus
Dsim\GD16238-PA 531 GD16238-PA 46..137 91..171 156 39.8 Plus
Dsim\GD21289-PA 2647 GD21289-PA 1249..1338 94..175 151 39.6 Plus
Dsim\GD12087-PA 625 GD12087-PA 164..249 90..177 144 37.5 Plus
Dsim\GD25223-PA 1216 GD25223-PA 940..1020 94..172 144 34.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11181-PA 195 GJ11181-PA 1..195 1..195 907 95.9 Plus
Dvir\GJ15244-PA 921 GJ15244-PA 384..496 72..185 203 41.2 Plus
Dvir\GJ14169-PA 1514 GJ14169-PA 915..1004 94..175 151 39.6 Plus
Dvir\GJ14084-PA 629 GJ14084-PA 160..245 90..177 147 38.6 Plus
Dvir\GJ21795-PA 1220 GJ21795-PA 959..1039 94..172 145 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12908-PA 195 GK12908-PA 1..195 1..195 906 95.4 Plus
Dwil\GK16229-PA 996 GK16229-PA 457..569 72..185 196 40.4 Plus
Dwil\GK10235-PA 522 GK10235-PA 37..128 91..171 157 39.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 1247..1343 89..175 152 38.8 Plus
Dwil\GK20633-PA 1192 GK20633-PA 931..1011 94..172 144 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10745-PA 195 GE10745-PA 1..195 1..195 1024 100 Plus
Dyak\GE15932-PA 902 GE15932-PA 365..477 72..185 201 40.4 Plus
Dyak\GE16793-PA 531 GE16793-PA 46..137 91..171 156 39.8 Plus
Dyak\GE23676-PA 1857 GE23676-PA 1237..1326 94..175 151 39.6 Plus
Dyak\GE13741-PA 1207 GE13741-PA 932..1012 94..172 145 34.6 Plus