Clone RE46906 Report

Search the DGRC for RE46906

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:469
Well:6
Vector:pFlc-1
Associated Gene/Transcriptcerv-RA
Protein status:RE46906.pep: gold
Preliminary Size:534
Sequenced Size:970

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15645 2002-01-01 Sim4 clustering to Release 2
CG15645 2003-01-01 Sim4 clustering to Release 3
CG15645 2003-05-20 Blastp of sequenced clone
CG15645 2008-04-29 Release 5.5 accounting
CG15645 2008-08-15 Release 5.9 accounting
cerv 2008-12-18 5.12 accounting

Clone Sequence Records

RE46906.complete Sequence

970 bp (970 high quality bases) assembled on 2003-05-20

GenBank Submission: BT011022

> RE46906.complete
AGCTGAACCTAGCTAAGCGTCAGTCTTGAACATTTGGATCCAAATATTCT
GGATTTGCAATTTGCAAAGCGTCTGCATAGAATCTGGGCTTTAAAATGGA
CTTCAATTACCATGTGGATTCGGCACTTACCACTTTATTGGAAAACCAAA
AGTTCTTCAAAGAAATGGCAGAAGTCGTGTCCGATTTCAGTGATGGCAGG
GAGATCCAGAAGTTGTTGGACCAGAACGTGGATCTCGCCGAGAATCTCAT
CCGAATGAAGAGCAAGCACCAATTGCTCAGCAAGGCTATGAAGCATGCCA
AAAACTCTAGCAACACCATCGAGAAGTTCGAGGAAGTCTGGAAGGAGCGC
TCCGAAGCGGTGGAGCAGAAGCGCATCGATGTCAAGAACTCAGCCGAGTT
CAAAAACTTCATGAAAGCGGCAGCTCCCCAGGCGGGTGCGGAAACAAATG
GTCAAGCGAATAGCGCCGCCCATGACGAGGACCTTATCATGGAAGCCACC
GGCGGCGAGGTCTTCTCGCTCTACGATCCCTGGTCCAAAGCCTTGATAAA
GAACCCCGTGCGCAACAAAAAGTGCGGCCACATCTACGACCGCGACTCGG
TGATGCTGATCATCACGGACAACATTGGTATTCGATGCCCAGTGCTCGGC
TGTCCCAACAGGTCCTACATCCATCCAGCGCACCTGGTCAAGGACTCCAA
CCTACAGCAGAAGTTGCAAGAGCGCATGTCTGACGCGATCGAGAAAGAAA
CTTCCTCGGAGGAGGACGATGAACAGGCAGATCATTAATTATGCGCAACT
TCCTTCTTGTCGACTAATAACGCAGCGTAAGATATCACGTTCTTGTAAGA
CAACCATTTGATGAAAATTTAAGGTACAACGAATAAACATGTTTTAAAAA
TAGTCCCGAAAAAATTTAGAGAAAATATATTAGAAGTGCAGTATGCACGT
ATATGAAAAAAAAAAAAAAA

RE46906.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
cerv-RA 1076 cerv-RA 122..1073 1..952 4760 100 Plus
cerv-RB 822 cerv-RB 40..819 173..952 3900 100 Plus
qjt-RA 931 qjt-RA 573..917 429..773 960 85.2 Plus
qjt-RA 931 qjt-RA 357..553 222..418 535 84.7 Plus
qjt-RA 931 qjt-RA 215..352 92..229 390 85.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15466875..15467654 952..173 3900 100 Minus
chr3L 24539361 chr3L 17468876..17469578 92..773 1600 82.5 Plus
chrX 22417052 chrX 15464953..15465429 792..298 970 80.2 Minus
chrX 22417052 chrX 15467698..15467871 174..1 870 100 Minus
chrX 22417052 chrX 15445295..15445629 792..458 820 83 Minus
chrX 22417052 chrX 15445674..15445768 392..298 385 93.7 Minus
chrX 22417052 chrX 14205142..14205241 855..954 350 90 Plus
chrX 22417052 chrX 14206599..14206730 818..954 330 86.1 Plus
chrX 22417052 chrX 14270400..14270531 954..818 330 86.1 Minus
chrX 22417052 chrX 15465584..15465651 83..15 220 91.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15576988..15577767 952..173 3900 100 Minus
3L 28110227 3L 17479358..17480060 92..773 1570 82.2 Plus
X 23542271 X 15575035..15575511 792..298 970 80.2 Minus
X 23542271 X 15577811..15577984 174..1 870 100 Minus
X 23542271 X 15555341..15555675 792..458 820 83 Minus
X 23542271 X 15555720..15555814 392..298 385 93.7 Minus
X 23542271 X 14314549..14314648 855..954 350 90 Plus
X 23542271 X 14316006..14316137 818..954 330 86.1 Plus
X 23542271 X 14379819..14379950 954..818 330 86.1 Minus
X 23542271 X 15575666..15575733 83..15 220 91.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15585086..15585865 952..173 3900 100 Minus
3L 28103327 3L 17472816..17473160 429..773 960 85.2 Plus
X 23527363 X 15585909..15586082 174..1 870 100 Minus
X 23527363 X 15563439..15563773 792..458 820 82.9 Minus
X 23527363 X 15583133..15583467 792..458 805 82.6 Minus
3L 28103327 3L 17472600..17472796 222..418 535 84.7 Plus
X 23527363 X 15583487..15583609 420..298 390 87.8 Minus
3L 28103327 3L 17472458..17472595 92..229 390 85.5 Plus
X 23527363 X 15563818..15563912 392..298 385 93.6 Minus
X 23527363 X 14322647..14322746 855..954 350 90 Plus
X 23527363 X 14324104..14324235 818..954 350 86.1 Plus
X 23527363 X 14387917..14388048 954..818 350 86.1 Minus
X 23527363 X 15583764..15583831 83..15 230 91.3 Minus
X 23527363 X 15564076..15564143 83..15 185 86.9 Minus
Blast to na_te.dros performed 2019-03-16 13:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 2619..2649 281..312 112 87.5 Plus

RE46906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:40:13 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15466872..15467652 175..955 99 <- Minus
chrX 15467698..15467871 1..174 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:01 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..693 96..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:34:50 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..693 96..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:07:07 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..693 96..788 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:10:32 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15645-RA 1..693 96..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:44 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..693 96..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:37:28 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..953 1..955 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:34:49 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 1..953 1..955 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:07:07 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 15..968 1..954 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:10:32 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15645-RA 1..953 1..955 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:44 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
cerv-RA 15..968 1..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:13 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
X 15576985..15577765 175..955 99 <- Minus
X 15577811..15577984 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:13 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
X 15576985..15577765 175..955 99 <- Minus
X 15577811..15577984 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:13 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
X 15576985..15577765 175..955 99 <- Minus
X 15577811..15577984 1..174 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:07:07 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15471018..15471798 175..955 99 <- Minus
arm_X 15471844..15472017 1..174 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:47:02 Download gff for RE46906.complete
Subject Subject Range Query Range Percent Splice Strand
X 15585083..15585863 175..955 99 <- Minus
X 15585909..15586082 1..174 100   Minus

RE46906.pep Sequence

Translation from 95 to 787

> RE46906.pep
MDFNYHVDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAEN
LIRMKSKHQLLSKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSA
EFKNFMKAAAPQAGAETNGQANSAAHDEDLIMEATGGEVFSLYDPWSKAL
IKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGCPNRSYIHPAHLVKD
SNLQQKLQERMSDAIEKETSSEEDDEQADH*

RE46906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22252-PA 248 GF22252-PA 1..224 1..212 425 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\cerv-PA 241 GG19392-PA 1..231 1..221 819 66.2 Plus
Dere\GG11876-PA 240 GG11876-PA 1..230 1..221 778 64.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22621-PA 226 GH22621-PA 1..226 1..224 417 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
cerv-PD 230 CG15645-PD 1..230 1..230 1187 100 Plus
cerv-PA 230 CG15645-PA 1..230 1..230 1187 100 Plus
cerv-PC 177 CG15645-PC 1..177 54..230 921 100 Plus
qjt-PB 233 CG13732-PB 1..233 1..226 805 69.1 Plus
qjt-PA 233 CG13732-PA 1..233 1..226 805 69.1 Plus
CG42299-PA 182 CG32584-PA 9..182 17..224 496 54.8 Plus
CG42300-PA 181 CG42300-PA 9..181 17..224 485 54.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15639-PA 226 GI15639-PA 1..208 1..208 344 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25912-PA 232 GL25912-PA 1..217 1..213 437 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25188-PA 232 GA25188-PA 1..217 1..213 427 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22549-PA 232 GM22549-PA 1..232 1..230 980 82.4 Plus
Dsec\qjt-PA 233 GM25704-PA 1..233 1..226 822 67.8 Plus
Dsec\GM22550-PA 200 GM22550-PA 13..200 45..230 788 82.5 Plus
Dsec\GM22546-PA 98 GM22546-PA 1..98 132..230 417 83.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\cerv-PA 232 GD15792-PA 1..232 1..230 1044 85 Plus
Dsim\qjt-PA 233 GD14711-PA 1..233 1..226 832 68.2 Plus
Dsim\GD15796-PA 196 GD15796-PA 1..108 1..108 432 77.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19226-PA 225 GJ19226-PA 1..208 1..208 341 37.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19230-PA 226 GK19230-PA 1..214 1..212 407 38.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\cerv-PA 238 GE16038-PA 1..237 1..227 870 69.6 Plus
Dyak\GE26335-PA 238 GE26335-PA 1..237 1..227 860 68.8 Plus

RE46906.hyp Sequence

Translation from 95 to 787

> RE46906.hyp
MDFNYHVDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAEN
LIRMKSKHQLLSKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSA
EFKNFMKAAAPQAGAETNGQANSAAHDEDLIMEATGGEVFSLYDPWSKAL
IKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGCPNRSYIHPAHLVKD
SNLQQKLQERMSDAIEKETSSEEDDEQADH*

RE46906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
cerv-PD 230 CG15645-PD 1..230 1..230 1187 100 Plus
cerv-PA 230 CG15645-PA 1..230 1..230 1187 100 Plus
cerv-PC 177 CG15645-PC 1..177 54..230 921 100 Plus
qjt-PB 233 CG13732-PB 1..233 1..226 805 69.1 Plus
qjt-PA 233 CG13732-PA 1..233 1..226 805 69.1 Plus