Clone RE47264 Report

Search the DGRC for RE47264

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:472
Well:64
Vector:pFlc-1
Associated Gene/TranscriptUbc10-RA
Protein status:RE47264.pep: gold
Sequenced Size:1012

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5788 2003-01-01 Sim4 clustering to Release 3
CG5788 2004-03-31 Blastp of sequenced clone
UbcD10 2008-04-29 Release 5.5 accounting
UbcD10 2008-08-15 Release 5.9 accounting
UbcD10 2008-12-18 5.12 accounting

Clone Sequence Records

RE47264.complete Sequence

1012 bp (1012 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012459

> RE47264.complete
AATTGGAAGATTCTTCAACGAACCATTTTCAGCGAAATTCGCAGACTTAC
GTGCGGATTTTTTTGGGCCAGTGCGAAAACCAAAGGTGACACCCCGCAAC
TGGAGCACTAGGAGCTCACCAACAACGAAACACCGGCGGCTGAACGAGAG
TATTACATATCCGGAAGACAAAACCATCGATTTGCAGCTCACACAAGGGC
AAACAAAAGTGCACACGCACACATTGGCAAGGTGGCCCCCTCCTCTTTCC
GTTCCACACACACCTACGCACACACCAGCATAAGAGAACCCACACATAGA
CATCACGATGACTGCGCCGCGACGCCTGCGAAAAGAATTGAGCGATTTGC
AGGGCAACGCACTGAAGTCCTTCCGGGACATTAAGGCGGACGATGACAAC
CTGCTGCGCTGGACGGGATTGATTGTCCCGGACAATCCGCCGTACAACAA
GGGCGCCTTCCGCATCGAGATCAACTTTCCGGCGGAGTATCCTTTCAAGC
CGCCCAAGATTAACTTTAAGACACGCATCTACCATCCAAACATCGATGAG
AAGGGCCAGGTGTGCTTGCCCATTATCAGTACGGAGAACTGGAAACCGGC
CACACGCACCGACCAGGTCGTGCAGGCACTGGTGGACTTAATCAACGACC
CTGAGCCGGAGCATCCGCTGCGGGCGGAGTTGGCCGAGGAGTTTCTTAAG
GATCGCAAAAAATTCGTGAAAAACGCCGAGGACTACACCAAGAAGCACAG
CGAAAAACGTCCGGCCGACTAGCGGATAGGCGGAGGTAGAGCTGGAGGAG
GTGGGCCAGTCCACAACCCATGTGTACCCTTACCCCTTAGTCTTGTGATT
TTTCTGTTAGTTATTTAATTTTCATTCTTGGTCCATGAAAAACTATCCTC
AGAAAACATTTAAGCAGATATTTCCCCGGCAGAGTACCTAGTTTTGTAAA
AGTAGCACTGTAATTTGATGCAAGTGAGAAATACATGTTCGTTATGTCAA
AAAAAAAAAAAA

RE47264.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
UbcD10-RA 1003 UbcD10-RA 1..1002 1..1002 4980 99.8 Plus
aft-RA 2414 aft-RA 2255..2414 1002..843 770 98.7 Minus
Ubc84D-RA 462 Ubc84D-RA 220..438 527..745 285 75.3 Plus
Ubc84D-RA 462 Ubc84D-RA 93..203 400..510 210 79.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13675566..13676562 997..1 4970 99.9 Minus
chr3R 27901430 chr3R 3344996..3345341 745..400 440 75.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17788408..17789409 1002..1 4980 99.8 Minus
3R 32079331 3R 7518921..7519266 745..400 440 75.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17789607..17790608 1002..1 4980 99.8 Minus
3R 31820162 3R 7259752..7259970 745..527 285 75.3 Minus
3R 31820162 3R 7259987..7260097 510..400 210 79.2 Minus
Blast to na_te.dros performed on 2019-03-16 13:40:49 has no hits.

RE47264.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:41:59 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13675565..13676562 1..998 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:12 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..465 308..772 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:47 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..465 308..772 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:08:29 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..465 308..772 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:35 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..465 308..772 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:46 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc10-RA 1..465 308..772 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:33 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..997 1..998 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:47 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..997 1..998 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:08:29 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 2..998 1..998 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:36 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD10-RA 1..997 1..998 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:46 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc10-RA 2..998 1..998 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:59 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17788412..17789409 1..998 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:59 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17788412..17789409 1..998 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:59 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17788412..17789409 1..998 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:08:29 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13675917..13676914 1..998 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:58:59 Download gff for RE47264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17789611..17790608 1..998 99   Minus

RE47264.hyp Sequence

Translation from 307 to 771

> RE47264.hyp
MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGA
FRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATR
TDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEK
RPAD*

RE47264.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc10-PA 154 CG5788-PA 1..154 1..154 823 100 Plus
Ubc84D-PA 153 CG12799-PA 1..152 1..152 581 66.4 Plus
CG17030-PA 180 CG17030-PA 9..163 1..154 411 45.8 Plus
eff-PC 147 CG7425-PC 2..146 3..148 286 39.5 Plus
eff-PB 147 CG7425-PB 2..146 3..148 286 39.5 Plus

RE47264.pep Sequence

Translation from 307 to 771

> RE47264.pep
MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGA
FRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATR
TDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEK
RPAD*

RE47264.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13219-PA 154 GF13219-PA 1..154 1..154 793 98.1 Plus
Dana\GF17299-PA 153 GF17299-PA 1..152 1..152 575 66.4 Plus
Dana\GF24708-PA 180 GF24708-PA 9..163 1..154 438 50.3 Plus
Dana\GF18131-PA 147 GF18131-PA 2..146 3..148 285 39.5 Plus
Dana\GF10262-PA 350 GF10262-PA 179..325 2..149 266 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21014-PA 154 GG21014-PA 1..154 1..154 786 97.4 Plus
Dere\GG25139-PA 153 GG25139-PA 1..152 1..152 582 67.1 Plus
Dere\GG14153-PA 180 GG14153-PA 9..163 1..154 410 46.5 Plus
Dere\GG21088-PA 147 GG21088-PA 2..146 3..148 285 39.5 Plus
Dere\GG10359-PA 232 GG10359-PA 86..231 2..148 260 36 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19845-PA 154 GH19845-PA 1..154 1..154 766 93.5 Plus
Dgri\GH19270-PA 152 GH19270-PA 1..152 1..152 533 61.2 Plus
Dgri\GH15783-PA 180 GH15783-PA 8..163 1..153 403 44.2 Plus
Dgri\GH14086-PA 147 GH14086-PA 2..146 3..148 285 39.5 Plus
Dgri\GH13340-PA 240 GH13340-PA 94..239 2..148 262 36 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc10-PA 154 CG5788-PA 1..154 1..154 823 100 Plus
Ubc84D-PA 153 CG12799-PA 1..152 1..152 581 66.4 Plus
CG17030-PA 180 CG17030-PA 9..163 1..154 411 45.8 Plus
eff-PC 147 CG7425-PC 2..146 3..148 286 39.5 Plus
eff-PB 147 CG7425-PB 2..146 3..148 286 39.5 Plus
eff-PA 147 CG7425-PA 2..146 3..148 286 39.5 Plus
CG5440-PC 169 CG5440-PC 21..167 2..149 263 35.6 Plus
CG5440-PB 169 CG5440-PB 21..167 2..149 263 35.6 Plus
Ubc2-PD 232 CG6720-PD 86..231 2..148 255 35.1 Plus
Ubc2-PC 232 CG6720-PC 86..231 2..148 255 35.1 Plus
Ubc2-PB 232 CG6720-PB 86..231 2..148 255 35.1 Plus
Ubc2-PA 232 CG6720-PA 86..231 2..148 255 35.1 Plus
CG10862-PA 354 CG10862-PA 212..354 6..149 250 35.9 Plus
ben-PE 151 CG18319-PE 5..148 4..148 245 32.7 Plus
ben-PD 151 CG18319-PD 5..148 4..148 245 32.7 Plus
ben-PB 151 CG18319-PB 5..148 4..148 245 32.7 Plus
ben-PC 151 CG18319-PC 5..148 4..148 245 32.7 Plus
ben-PA 151 CG18319-PA 5..148 4..148 245 32.7 Plus
CG2574-PA 239 CG2574-PA 66..213 6..154 235 34.4 Plus
CG40045-PA 168 CG40045-PA 10..166 7..150 234 28.7 Plus
CG40045-PD 167 CG40045-PD 10..165 7..150 228 27.6 Plus
Ubc87F-PA 168 CG9602-PA 10..166 7..150 223 27.4 Plus
CG3473-PB 151 CG3473-PB 42..148 41..148 217 35.2 Plus
CG3473-PA 151 CG3473-PA 42..148 41..148 217 35.2 Plus
UbcE2M-PC 181 CG7375-PC 27..162 3..141 212 33.8 Plus
UbcE2M-PB 181 CG7375-PB 27..162 3..141 212 33.8 Plus
UbcE2M-PA 181 CG7375-PA 27..162 3..141 212 33.8 Plus
vih-PA 178 CG10682-PA 35..177 5..149 211 31.1 Plus
Ubc6-PC 151 CG2013-PC 5..142 3..141 209 28.6 Plus
Ubc6-PA 151 CG2013-PA 5..142 3..141 209 28.6 Plus
CG7656-PE 319 CG7656-PE 40..192 2..141 204 28.1 Plus
CG7656-PD 319 CG7656-PD 40..192 2..141 204 28.1 Plus
CG7656-PF 317 CG7656-PF 40..175 2..124 202 29.4 Plus
CG7656-PA 317 CG7656-PA 40..175 2..124 202 29.4 Plus
Ubc4-PC 199 CG8284-PC 46..153 41..148 186 37.6 Plus
Ubc4-PB 199 CG8284-PB 46..153 41..148 186 37.6 Plus
Ubc4-PA 199 CG8284-PA 46..153 41..148 186 37.6 Plus
CG40045-PC 132 CG40045-PC 6..130 38..150 184 28 Plus
morgue-PA 491 CG15437-PA 342..483 7..148 182 29.6 Plus
UbcE2H-PB 183 CG2257-PB 41..149 41..148 179 32.7 Plus
UbcE2H-PC 183 CG2257-PC 41..149 41..148 179 32.7 Plus
UbcE2H-PA 183 CG2257-PA 41..149 41..148 179 32.7 Plus
lwr-PD 159 CG3018-PD 37..146 31..138 176 30.9 Plus
lwr-PC 159 CG3018-PC 37..146 31..138 176 30.9 Plus
lwr-PB 159 CG3018-PB 37..146 31..138 176 30.9 Plus
lwr-PA 159 CG3018-PA 37..146 31..138 176 30.9 Plus
Ubc7-PB 167 CG4443-PB 4..161 2..146 176 26.6 Plus
Ubc7-PA 167 CG4443-PA 4..161 2..146 176 26.6 Plus
CG8188-PD 209 CG8188-PD 17..160 5..149 164 24.1 Plus
CG8188-PC 209 CG8188-PC 17..160 5..149 164 24.1 Plus
CG8188-PB 209 CG8188-PB 17..160 5..149 164 24.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20435-PA 154 GI20435-PA 1..154 1..154 766 93.5 Plus
Dmoj\GI23479-PA 153 GI23479-PA 1..152 1..152 572 63.8 Plus
Dmoj\GI12563-PA 179 GI12563-PA 8..162 1..154 404 43.2 Plus
Dmoj\GI10619-PA 147 GI10619-PA 2..146 3..148 285 39.5 Plus
Dmoj\GI17815-PA 240 GI17815-PA 94..239 2..148 262 36 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17270-PA 154 GL17270-PA 1..154 1..154 775 95.5 Plus
Dper\GL12172-PA 154 GL12172-PA 1..153 1..152 525 60.8 Plus
Dper\GL23670-PA 147 GL23670-PA 2..146 3..148 285 39.5 Plus
Dper\GL22516-PA 220 GL22516-PA 66..208 5..149 264 34.9 Plus
Dper\GL26387-PA 228 GL26387-PA 82..227 2..148 259 36 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19129-PA 154 GA19129-PA 1..154 1..154 775 95.5 Plus
Dpse\GA26215-PA 154 GA26215-PA 1..153 1..152 530 61.4 Plus
Dpse\GA28328-PA 217 GA28328-PA 65..200 19..154 380 45.6 Plus
Dpse\GA26693-PA 147 GA26693-PA 2..146 3..148 285 39.5 Plus
Dpse\GA24534-PA 212 GA24534-PA 55..197 5..149 269 36.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19945-PA 154 GM19945-PA 1..154 1..154 796 98.1 Plus
Dsec\GM23061-PA 154 GM23061-PA 1..154 1..154 727 87.7 Plus
Dsec\GM10475-PA 153 GM10475-PA 1..152 1..152 581 67.1 Plus
Dsec\GM13939-PA 180 GM13939-PA 9..163 1..154 404 45.8 Plus
Dsec\GM25828-PA 147 GM25828-PA 2..146 3..148 285 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25436-PA 154 GD25436-PA 1..154 1..154 796 98.1 Plus
Dsim\GD17512-PA 154 GD17512-PA 1..154 1..154 708 85.1 Plus
Dsim\GD19477-PA 153 GD19477-PA 1..152 1..152 581 67.1 Plus
Dsim\GD13222-PA 180 GD13222-PA 9..163 1..154 404 45.8 Plus
Dsim\GD13221-PA 162 GD13221-PA 9..156 1..147 385 45.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20107-PA 154 GJ20107-PA 1..154 1..154 766 93.5 Plus
Dvir\GJ10233-PA 153 GJ10233-PA 1..152 1..152 574 65.1 Plus
Dvir\GJ15466-PA 178 GJ15466-PA 8..162 1..154 400 44.5 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 2..146 3..148 285 39.5 Plus
Dvir\GJ17643-PA 240 GJ17643-PA 94..239 2..148 261 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22072-PA 154 GK22072-PA 1..154 1..154 764 92.9 Plus
Dwil\GK11079-PA 153 GK11079-PA 1..152 1..152 536 61.2 Plus
Dwil\GK17587-PA 158 GK17587-PA 8..152 1..144 413 48.3 Plus
Dwil\GK11688-PA 147 GK11688-PA 2..146 3..148 285 39.5 Plus
Dwil\GK16336-PA 241 GK16336-PA 92..239 2..150 273 37.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\UbcD10-PA 154 GE13957-PA 1..154 1..154 793 98.1 Plus
Dyak\GE25785-PA 153 GE25785-PA 1..152 1..152 581 67.1 Plus
Dyak\GE20579-PA 180 GE20579-PA 9..163 1..154 410 46.5 Plus
Dyak\eff-PA 147 GE26430-PA 2..146 3..148 285 39.5 Plus
Dyak\GE13339-PA 232 GE13339-PA 86..231 2..148 260 36 Plus