Clone RE47308 Report

Search the DGRC for RE47308

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:473
Well:8
Vector:pFlc-1
Associated Gene/TranscriptRbp1-like-RA
Protein status:RE47308.pep: gold
Sequenced Size:929

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1987 2002-01-01 Sim4 clustering to Release 2
CG1987 2002-04-26 Blastp of sequenced clone
CG1987 2003-01-01 Sim4 clustering to Release 3
Rbp1-like 2008-04-29 Release 5.5 accounting
Rbp1-like 2008-08-15 Release 5.9 accounting
Rbp1-like 2008-12-18 5.12 accounting

Clone Sequence Records

RE47308.complete Sequence

929 bp (929 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113490

> RE47308.complete
AAAACACTTTTTTCTGCTCCTGCTTTGTGGGTGTGCTCTTTGAAAAACCA
AGGAGAATTCCCTCGGAATAGCATCAAAACAAACTGGAAAATTGACTTTG
GACAAGTCCAGTGGTACAACAAATACCAAAAATCCATTACAGAACCGGAG
GAGCAGCACCTCCAGCCACATACATATTCATACATAATGCCACGCTACCG
TGAATGGGATTTAGCCTGCAAAGTTTACGTGGGCAATCTGGGATCCTCGG
CCTCCAAATACGAGATCGAGAACGCCTTTAGCAAATACGGACCCTTGCGC
AACGTCTGGGTGGCCCGCAATCCGCCCGGTTTCGCCTTCGTCGAGTTCGA
GGATCGTCGCGACGCTGAGGATGCGACCCGTGGCCTCGACGGCACCCGCT
GCTGTGGCACCCGCATCCGTGTCGAAATGTCATCAGGCCGTTCACGAGAG
GGTCGCGGCGGTGGCGGTGGAGGCGGCGGTGGTGGAGGCGGATCCGGTGG
CGGCGGCCGCGGCGGTGGCAGTGGCGCCCGTGCTGGAGGCGGTGGAAGGG
CTGGCGATGGCGGTGGACGCTATAGATCACGCTCACCCCGCCGCTCAAGG
ACACGCAGCCGCAGCTTTTCGAGGGATCGTCGCAGTCGCTCCGACTCCAG
GGACCGCCATTAGATGAGAAGAGTAGTAGTGGGATGCAGCCCAAAACTGG
ACTCCACAACACACACATATATATAGATATATATATATATTATACATATA
CAGAGATATATACATAAAGTAGTACGGCCCCAGAGTTGAGGACAAAAAGG
ATCTGTTTTGCCAGACGAAAAATGGCTCAACAGATTTCTGAAGTTTGACT
CAATAAATTCGTCCCCCTCCATATAATAACCCCCCCCCCCCCACAGAGAA
CAAAACCAAAAAACAAAAAAAAAAAAAAA

RE47308.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-like-RA 1075 Rbp1-like-RA 85..1009 2..926 4625 100 Plus
Rbp1-like.a 1536 Rbp1-like.a 85..1009 2..926 4625 100 Plus
Rbp1-RC 762 Rbp1-RC 95..319 186..410 465 80.4 Plus
Rbp1-RC 762 Rbp1-RC 444..502 604..662 145 83 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13275075..13275648 575..2 2870 100 Minus
chrX 22417052 chrX 13271486..13271826 914..574 1675 99.4 Minus
chr3R 27901430 chr3R 6610126..6610371 186..431 480 79.7 Plus
chr2L 23010047 chr2L 6918885..6918941 351..295 195 89.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13384300..13384873 575..2 2870 100 Minus
X 23542271 X 13380693..13381045 926..574 1765 100 Minus
3R 32079331 3R 10784606..10784830 186..410 465 80.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13392398..13392971 575..2 2870 100 Minus
X 23527363 X 13388791..13389143 926..574 1765 100 Minus
3R 31820162 3R 10525437..10525661 186..410 465 80.4 Plus
3R 31820162 3R 10527020..10527078 604..662 145 83 Plus
Blast to na_te.dros performed on 2019-03-15 19:55:04 has no hits.

RE47308.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13275196..13275648 1..454 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:14 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..477 187..663 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:50:06 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..477 187..663 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:00:15 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..477 187..663 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:42 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..477 187..663 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..477 187..663 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:27:19 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..913 2..914 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:50:06 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..913 2..914 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:00:15 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 3..917 1..914 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:42 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 1..913 2..914 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-like-RA 3..917 1..914 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
X 13380705..13381043 576..914 100 <- Minus
X 13384300..13384873 1..575 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
X 13380705..13381043 576..914 100 <- Minus
X 13384300..13384873 1..575 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:05 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
X 13380705..13381043 576..914 100 <- Minus
X 13384300..13384873 1..575 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:00:15 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13274738..13275076 576..914 100 <- Minus
arm_X 13278333..13278906 1..575 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:01 Download gff for RE47308.complete
Subject Subject Range Query Range Percent Splice Strand
X 13388803..13389141 576..914 100 <- Minus
X 13392398..13392971 1..575 99   Minus

RE47308.hyp Sequence

Translation from 3 to 662

> RE47308.hyp
TLFSAPALWVCSLKNQGEFPRNSIKTNWKIDFGQVQWYNKYQKSITEPEE
QHLQPHTYSYIMPRYREWDLACKVYVGNLGSSASKYEIENAFSKYGPLRN
VWVARNPPGFAFVEFEDRRDAEDATRGLDGTRCCGTRIRVEMSSGRSREG
RGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGGRYRSRSPRRSRT
RSRSFSRDRRSRSDSRDRH*

RE47308.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-like-PC 158 CG1987-PC 1..158 62..219 852 100 Plus
Rbp1-like-PA 158 CG1987-PA 1..158 62..219 852 100 Plus
Rbp1-like-PB 247 CG1987-PB 1..139 62..200 718 95 Plus
Rbp1-PA 135 CG17136-PA 1..135 62..219 591 75.5 Plus
Rbp1-PD 144 CG17136-PD 1..101 62..162 479 88.1 Plus

RE47308.pep Sequence

Translation from 186 to 662

> RE47308.pep
MPRYREWDLACKVYVGNLGSSASKYEIENAFSKYGPLRNVWVARNPPGFA
FVEFEDRRDAEDATRGLDGTRCCGTRIRVEMSSGRSREGRGGGGGGGGGG
GGSGGGGRGGGSGARAGGGGRAGDGGGRYRSRSPRRSRTRSRSFSRDRRS
RSDSRDRH*

RE47308.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19500-PA 179 GF19500-PA 1..81 1..81 453 100 Plus
Dana\GF17902-PA 163 GF17902-PA 1..81 1..81 451 97.5 Plus
Dana\GF14123-PA 192 GF14123-PA 7..78 11..82 217 54.2 Plus
Dana\GF16525-PA 253 GF16525-PA 7..81 11..84 157 46.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19507-PA 159 GG19507-PA 1..159 1..158 745 99.4 Plus
Dere\GG17683-PA 144 GG17683-PA 1..81 1..81 432 95.1 Plus
Dere\GG23961-PA 200 GG23961-PA 10..81 11..82 220 54.2 Plus
Dere\GG22670-PA 154 GG22670-PA 29..122 10..99 136 37.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24472-PA 163 GH24472-PA 1..163 1..158 699 93.3 Plus
Dgri\GH13017-PA 201 GH13017-PA 7..78 11..82 220 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-like-PC 158 CG1987-PC 1..158 1..158 852 100 Plus
Rbp1-like-PA 158 CG1987-PA 1..158 1..158 852 100 Plus
Rbp1-like-PB 247 CG1987-PB 1..139 1..139 718 95 Plus
Rbp1-PA 135 CG17136-PA 1..135 1..158 591 75.5 Plus
Rbp1-PD 144 CG17136-PD 1..101 1..101 479 88.1 Plus
x16-PA 258 CG10203-PA 9..163 12..157 403 55.5 Plus
x16-PB 257 CG10203-PB 9..162 12..157 402 55.8 Plus
Rsf1-PB 200 CG5655-PB 11..148 12..157 286 44.5 Plus
Rsf1-PA 200 CG5655-PA 11..148 12..157 286 44.5 Plus
caz-PD 355 CG3606-PD 78..213 13..129 201 34.6 Plus
caz-PC 384 CG3606-PC 107..242 13..129 201 34.6 Plus
caz-PB 399 CG3606-PB 122..257 13..129 201 34.6 Plus
SC35-PD 195 CG5442-PD 27..160 15..157 195 36.2 Plus
SC35-PC 195 CG5442-PC 27..160 15..157 195 36.2 Plus
SC35-PB 195 CG5442-PB 27..160 15..157 195 36.2 Plus
SF2-PB 255 CG6987-PB 7..116 11..142 184 37.6 Plus
SF2-PA 255 CG6987-PA 7..116 11..142 184 37.6 Plus
snRNP-U1-70K-PC 448 CG8749-PC 104..288 13..157 166 30.1 Plus
snRNP-U1-70K-PA 448 CG8749-PA 104..288 13..157 166 30.1 Plus
CG4038-PA 237 CG4038-PA 1..46 81..126 160 65.2 Plus
B52-PI 135 CG10851-PI 5..97 12..100 158 39.6 Plus
B52-PD 135 CG10851-PD 5..97 12..100 158 39.6 Plus
B52-PK 147 CG10851-PK 5..97 12..100 158 39.6 Plus
B52-PF 147 CG10851-PF 5..97 12..100 158 39.6 Plus
B52-PB 329 CG10851-PB 5..97 12..100 158 39.6 Plus
B52-PN 350 CG10851-PN 5..97 12..100 158 39.6 Plus
B52-PC 350 CG10851-PC 5..97 12..100 158 39.6 Plus
B52-PA 350 CG10851-PA 5..97 12..100 158 39.6 Plus
B52-PO 355 CG10851-PO 5..97 12..100 158 39.6 Plus
B52-PM 355 CG10851-PM 5..97 12..100 158 39.6 Plus
Cpr47Ef-PD 601 CG13214-PD 239..297 82..134 153 57.6 Plus
Cpr47Ef-PC 612 CG13214-PC 239..297 82..134 153 57.6 Plus
CG4038-PA 237 CG4038-PA 14..68 84..136 151 58.9 Plus
CG14742-PA 74 CG14742-PA 2..49 84..127 151 58.3 Plus
Fib-PA 344 CG9888-PA 57..104 84..127 149 62.7 Plus
CG4038-PA 237 CG4038-PA 11..54 84..128 147 66.7 Plus
Fib-PA 344 CG9888-PA 7..58 83..128 147 63.5 Plus
Nopp140-PA 720 CG7421-PA 624..714 48..138 147 39.6 Plus
Nopp140-PE 773 CG7421-PE 677..767 48..138 147 39.6 Plus
CG1840-PB 117 CG1840-PB 59..93 84..118 146 77.1 Plus
CG1840-PA 118 CG1840-PA 60..94 84..118 146 77.1 Plus
B52-PB 329 CG10851-PB 121..274 12..157 145 29.9 Plus
B52-PN 350 CG10851-PN 116..269 12..157 145 29.9 Plus
B52-PC 350 CG10851-PC 116..269 12..157 145 29.9 Plus
B52-PA 350 CG10851-PA 116..269 12..157 145 29.9 Plus
B52-PO 355 CG10851-PO 121..274 12..157 145 29.9 Plus
B52-PM 355 CG10851-PM 121..274 12..157 145 29.9 Plus
CG5913-PA 454 CG5913-PA 322..398 80..157 145 41 Plus
Rox8-PC 464 CG5422-PC 97..204 13..112 145 33.3 Plus
Rox8-PB 464 CG5422-PB 97..204 13..112 145 33.3 Plus
Rox8-PH 470 CG5422-PH 97..204 13..112 145 33.3 Plus
Rox8-PG 470 CG5422-PG 97..204 13..112 145 33.3 Plus
Rox8-PE 470 CG5422-PE 97..204 13..112 145 33.3 Plus
CG10853-PA 155 CG10853-PA 55..87 91..123 143 75.8 Plus
rump-PB 214 CG9373-PB 57..213 11..157 143 29.9 Plus
CG11458-PA 98 CG11458-PA 49..97 80..126 142 55.1 Plus
CG13376-PC 193 CG13376-PC 48..103 77..127 140 55.4 Plus
CG13376-PB 200 CG13376-PB 55..110 77..127 140 55.4 Plus
CG13376-PD 204 CG13376-PD 59..114 77..127 140 55.4 Plus
CG11458-PA 98 CG11458-PA 46..93 84..129 139 56.2 Plus
CG14742-PA 74 CG14742-PA 12..62 89..135 137 56.9 Plus
CG5172-PC 106 CG5172-PC 11..70 72..129 137 47.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15337-PA 151 GI15337-PA 1..81 1..81 443 100 Plus
Dmoj\GI23736-PA 137 GI23736-PA 1..81 1..81 432 95.1 Plus
Dmoj\GI19446-PA 196 GI19446-PA 7..78 11..82 222 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26725-PA 174 GL26725-PA 1..81 1..81 444 100 Plus
Dper\GL18979-PA 196 GL18979-PA 10..92 11..93 241 54.2 Plus
Dper\GL22249-PA 263 GL22249-PA 7..81 11..84 157 46.1 Plus
Dper\GL12592-PA 154 GL12592-PA 29..122 10..99 138 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15173-PA 161 GA15173-PA 1..81 1..81 443 100 Plus
Dpse\GA30013-PA 259 GA30013-PA 9..82 12..85 259 64.9 Plus
Dpse\GA19037-PA 196 GA19037-PA 10..92 11..93 241 54.2 Plus
Dpse\GA20008-PA 263 GA20008-PA 7..81 11..84 157 46.1 Plus
Dpse\GA11577-PA 154 GA11577-PA 29..122 10..99 138 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23896-PA 144 GM23896-PA 1..81 1..81 432 95.1 Plus
Dsec\GM13734-PA 226 GM13734-PA 9..82 12..85 249 64.9 Plus
Dsec\GM11879-PA 200 GM11879-PA 10..81 11..82 220 54.2 Plus
Dsec\GM15280-PA 154 GM15280-PA 29..122 10..99 137 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18708-PA 144 GD18708-PA 1..81 1..81 432 95.1 Plus
Dsim\GD22286-PA 200 GD22286-PA 10..81 11..82 220 54.2 Plus
Dsim\GD19204-PA 154 GD19204-PA 29..122 10..99 137 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10582-PA 140 GJ10582-PA 1..88 1..88 451 92 Plus
Dvir\GJ14774-PA 155 GJ14774-PA 1..81 1..81 440 98.8 Plus
Dvir\GJ17527-PA 198 GJ17527-PA 7..78 11..82 218 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16401-PA 176 GK16401-PA 1..81 1..81 450 100 Plus
Dwil\GK13897-PA 140 GK13897-PA 1..81 1..81 441 97.5 Plus
Dwil\GK12439-PA 192 GK12439-PA 7..78 11..82 218 54.2 Plus
Dwil\GK13511-PA 263 GK13511-PA 7..78 11..81 153 46.6 Plus
Dwil\GK11244-PA 154 GK11244-PA 29..122 10..99 139 37.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16161-PA 160 GE16161-PA 1..160 1..158 745 98.8 Plus
Dyak\GE26048-PA 135 GE26048-PA 1..81 1..81 425 95.1 Plus
Dyak\GE26241-PA 200 GE26241-PA 10..81 11..82 220 54.2 Plus
Dyak\GE25514-PA 154 GE25514-PA 29..122 10..99 137 37.9 Plus