Clone RE47447 Report

Search the DGRC for RE47447

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:474
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG7567-RA
Protein status:RE47447.pep: gold
Preliminary Size:664
Sequenced Size:777

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7567 2002-01-01 Sim4 clustering to Release 2
CG7567 2002-05-19 Blastp of sequenced clone
CG7567 2003-01-01 Sim4 clustering to Release 3
CG7567 2008-04-29 Release 5.5 accounting
CG7567 2008-08-15 Release 5.9 accounting
CG7567 2008-12-18 5.12 accounting

Clone Sequence Records

RE47447.complete Sequence

777 bp (777 high quality bases) assembled on 2002-05-19

GenBank Submission: AY119142

> RE47447.complete
ATTCAGTAAGAAGTGGAATCTGAGACTTTTAGCCATGTTTTCCAAATTCT
CCCTGCTCGCCGTGGTTCTCGCTTTTGGCCTGGTTTCTGGCCTCAGCCTT
AGCCTCGTGGTAAAGCCTTCCAAGCTGAAGCTGCCCACCAACAAGAAGAT
CCTTGGCCTTCAGCAGCAAACGGAAGAGCTGGCTGCTCGGGATCCTGGCA
CTTCGGTACGCTGCTTCGACTACTACATACCCATCATCAACGGGCTGTCG
GCCCAGTACGAACTGGACTACAATAAGTGCGTTAAGGACTACGACACCGC
CAGCGAACTGGTCCTCGCCGCCTGGAACAGCACTCTCTTCGGCATCCAGG
CTTCCGGGGATCGTGGCTGCAACACCTTCTTCGACTGCTCCTCCATTGTG
GACTTCGTGCTCGCCTTCGAGTGCTTCGCCAACGTCGGAGCTGAGCAATC
AAAAATCATGTACCAAGTCTCGGCGAATGCCACCGAAGCCGCCGTCCAGA
TCAAGATCCATTTGCAGACTTTGGACAGCCAGTTGGAAAGCTGCTTGAAC
TATTCCGAAAAGGATTTCGTGGAGGGCACCTCGCTCTACTATGGAGAACT
CAACAAATGCCTTGCTGGAGCTCCAGTTCCGCAGGATACCACTGCAAATT
GGTATTATACCACCGCCTAAAACCTGATAAGGTTTATTCTAAAAACTAAA
CAAAAAGAAATATGATTATGCCAAATTAAAATGTGTGCTTTCATGCTTTA
CAAACACACAAAAGTGAAAAAAAAAAA

RE47447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7567-RA 1025 CG7567-RA 109..875 1..767 3835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25410241..25410677 437..1 2155 99.5 Minus
chr3R 27901430 chr3R 25409814..25410143 766..437 1620 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:58:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29587664..29588100 437..1 2185 100 Minus
3R 32079331 3R 29587236..29587566 767..437 1655 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29328495..29328931 437..1 2185 100 Minus
3R 31820162 3R 29328067..29328397 767..437 1655 100 Minus
Blast to na_te.dros performed 2019-03-16 12:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
opus 7521 opus OPUS 7521bp 6757..6797 65..27 110 78 Minus

RE47447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:05 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25409814..25410143 437..766 99 <- Minus
chr3R 25410242..25410677 1..436 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:16 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..636 35..670 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:23 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..636 35..670 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:22:15 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..636 35..670 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:08 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..636 35..670 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:43 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..636 35..670 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:37 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..766 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:23 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..766 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:22:15 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 5..770 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:08 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 1..766 1..766 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:43 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
CG7567-RA 5..770 1..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:05 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29587237..29587566 437..766 100 <- Minus
3R 29587665..29588100 1..436 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:05 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29587237..29587566 437..766 100 <- Minus
3R 29587665..29588100 1..436 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:05 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29587237..29587566 437..766 100 <- Minus
3R 29587665..29588100 1..436 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:22:15 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25412959..25413288 437..766 100 <- Minus
arm_3R 25413387..25413822 1..436 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:43 Download gff for RE47447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29328068..29328397 437..766 100 <- Minus
3R 29328496..29328931 1..436 100   Minus

RE47447.hyp Sequence

Translation from 0 to 669

> RE47447.hyp
FSKKWNLRLLAMFSKFSLLAVVLAFGLVSGLSLSLVVKPSKLKLPTNKKI
LGLQQQTEELAARDPGTSVRCFDYYIPIINGLSAQYELDYNKCVKDYDTA
SELVLAAWNSTLFGIQASGDRGCNTFFDCSSIVDFVLAFECFANVGAEQS
KIMYQVSANATEAAVQIKIHLQTLDSQLESCLNYSEKDFVEGTSLYYGEL
NKCLAGAPVPQDTTANWYYTTA*

RE47447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7567-PA 211 CG7567-PA 1..211 12..222 1088 100 Plus
CG10911-PA 359 CG10911-PA 1..196 18..215 247 28.4 Plus
CG10912-PA 271 CG10912-PA 5..196 18..214 229 28.3 Plus
CG11470-PB 230 CG11470-PB 2..212 16..221 226 30.6 Plus
CG11470-PA 230 CG11470-PA 2..212 16..221 226 30.6 Plus

RE47447.pep Sequence

Translation from 34 to 669

> RE47447.pep
MFSKFSLLAVVLAFGLVSGLSLSLVVKPSKLKLPTNKKILGLQQQTEELA
ARDPGTSVRCFDYYIPIINGLSAQYELDYNKCVKDYDTASELVLAAWNST
LFGIQASGDRGCNTFFDCSSIVDFVLAFECFANVGAEQSKIMYQVSANAT
EAAVQIKIHLQTLDSQLESCLNYSEKDFVEGTSLYYGELNKCLAGAPVPQ
DTTANWYYTTA*

RE47447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22881-PA 228 GF22881-PA 1..200 1..200 564 52 Plus
Dana\GF23352-PA 223 GF23352-PA 1..194 1..195 240 31.8 Plus
Dana\GF24864-PA 250 GF24864-PA 6..201 3..200 219 29.8 Plus
Dana\GF13208-PA 377 GF13208-PA 46..204 53..211 219 29.6 Plus
Dana\GF13207-PA 263 GF13207-PA 5..187 7..195 180 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12014-PA 210 GG12014-PA 1..210 1..210 974 84.8 Plus
Dere\GG20997-PA 383 GG20997-PA 5..196 8..204 236 30.2 Plus
Dere\GG12013-PA 233 GG12013-PA 6..201 9..198 222 32.8 Plus
Dere\GG20996-PA 284 GG20996-PA 4..193 6..200 205 28.1 Plus
Dere\GG14514-PA 249 GG14514-PA 1..200 2..200 198 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20448-PA 278 GH20448-PA 1..184 1..195 222 25.6 Plus
Dgri\GH15758-PA 256 GH15758-PA 11..199 7..200 201 29.4 Plus
Dgri\GH20449-PA 205 GH20449-PA 1..178 1..195 196 26.2 Plus
Dgri\GH20451-PA 184 GH20451-PA 20..157 58..195 181 27.5 Plus
Dgri\GH21443-PA 174 GH21443-PA 25..163 55..193 157 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG7567-PA 211 CG7567-PA 1..211 1..211 1088 100 Plus
CG10911-PA 359 CG10911-PA 1..196 7..204 247 28.4 Plus
CG10912-PA 271 CG10912-PA 5..196 7..203 229 28.3 Plus
CG11470-PB 230 CG11470-PB 2..212 5..210 226 30.6 Plus
CG11470-PA 230 CG11470-PA 2..212 5..210 226 30.6 Plus
CG16762-PA 254 CG16762-PA 6..218 3..210 201 28.1 Plus
CG5767-PA 253 CG5767-PA 49..195 57..204 173 25.7 Plus
CG5770-PA 213 CG5770-PA 2..196 6..205 163 22.9 Plus
CG34005-PC 185 CG34005-PC 41..179 55..193 150 27.9 Plus
CG34005-PB 185 CG34005-PB 41..179 55..193 150 27.9 Plus
CG31041-PA 198 CG31041-PA 41..184 50..193 148 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24462-PA 213 GI24462-PA 15..182 25..195 308 36.3 Plus
Dmoj\GI24461-PA 231 GI24461-PA 1..196 5..203 291 31.2 Plus
Dmoj\GI19278-PA 253 GI19278-PA 1..184 1..195 254 29.2 Plus
Dmoj\GI24460-PA 223 GI24460-PA 1..189 7..195 242 29.3 Plus
Dmoj\GI19276-PA 375 GI19276-PA 21..188 38..204 236 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13587-PA 220 GL13587-PA 1..194 1..201 471 48.8 Plus
Dper\GL13586-PA 221 GL13586-PA 1..197 1..195 241 28.7 Plus
Dper\GL13585-PA 197 GL13585-PA 50..193 60..203 222 33.3 Plus
Dper\GL24611-PA 258 GL24611-PA 34..200 28..195 203 29.2 Plus
Dper\GL10540-PA 356 GL10540-PA 1..189 7..199 189 25.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26834-PA 218 GA26834-PA 1..194 1..201 475 48.8 Plus
Dpse\GA26833-PA 221 GA26833-PA 1..197 1..195 240 28.7 Plus
Dpse\GA15961-PA 197 GA15961-PA 50..193 60..203 222 33.3 Plus
Dpse\GA14134-PA 258 GA14134-PA 34..200 28..195 203 29.2 Plus
Dpse\GA10635-PA 372 GA10635-PA 1..189 7..199 198 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12239-PA 211 GM12239-PA 1..211 1..211 1017 90.5 Plus
Dsec\GM12238-PA 236 GM12238-PA 2..212 5..210 237 31.9 Plus
Dsec\GM19931-PA 366 GM19931-PA 1..196 7..204 225 30 Plus
Dsec\GM14119-PA 239 GM14119-PA 61..190 71..200 165 27.7 Plus
Dsec\GM19930-PA 246 GM19930-PA 5..185 7..193 158 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17731-PA 199 GD17731-PA 5..199 17..211 918 87.2 Plus
Dsim\GD17726-PA 236 GD17726-PA 2..217 5..206 235 31.7 Plus
Dsim\GD25420-PA 381 GD25420-PA 1..196 7..204 232 29 Plus
Dsim\GD13390-PA 250 GD13390-PA 1..200 2..200 200 28.4 Plus
Dsim\GD25419-PA 287 GD25419-PA 5..193 7..200 179 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10552-PA 206 GJ10552-PA 20..182 30..195 319 38 Plus
Dvir\GJ10551-PA 211 GJ10551-PA 1..199 1..203 314 36.7 Plus
Dvir\GJ10550-PA 211 GJ10550-PA 1..187 7..195 269 30.7 Plus
Dvir\GJ10549-PA 211 GJ10549-PA 1..187 7..195 269 30.7 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 1..184 1..195 239 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17899-PA 237 GK17899-PA 1..197 1..195 304 37.9 Plus
Dwil\GK11180-PA 229 GK11180-PA 1..197 1..195 303 38.4 Plus
Dwil\GK22059-PA 340 GK22059-PA 1..185 1..199 242 29 Plus
Dwil\GK12510-PA 326 GK12510-PA 11..194 11..200 210 30 Plus
Dwil\GK22057-PA 259 GK22057-PA 31..195 38..201 176 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10450-PA 211 GE10450-PA 1..211 1..210 887 78.2 Plus
Dyak\GE10449-PA 225 GE10449-PA 2..195 5..193 207 31.7 Plus
Dyak\GE13940-PA 406 GE13940-PA 2..191 4..199 200 27.3 Plus
Dyak\GE21706-PA 254 GE21706-PA 5..204 2..200 188 26.6 Plus
Dyak\GE13939-PA 272 GE13939-PA 5..193 7..200 174 24.6 Plus