Clone RE47570 Report

Search the DGRC for RE47570

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:475
Well:70
Vector:pFlc-1
Associated Gene/Transcriptmsd5-RA
Protein status:RE47570.pep: gold
Preliminary Size:773
Sequenced Size:855

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2213 2002-01-01 Sim4 clustering to Release 2
CG2213 2002-01-03 Blastp of sequenced clone
CG2213 2003-01-01 Sim4 clustering to Release 3
CG2213 2008-04-29 Release 5.5 accounting
CG2213 2008-08-15 Release 5.9 accounting
CG2213 2008-12-18 5.12 accounting

Clone Sequence Records

RE47570.complete Sequence

855 bp (855 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075493

> RE47570.complete
ATCAAAGGAGAAGTGAAGCGTAAACAATAAAAATGGAAACTAATGTAGAT
TTCAGCAGCATTTCATCCAAGTTGTACAGAAAGTACGCGCAACATGTGAG
AAACCTAAAGGACGTGTGCGTATCCAAGACGGTGATGAAACCGGGGGCCT
TCTTTGACAGCCTGCAGCAGATGATGGAGGAGGAGGCAGCAGCCACTACG
CCCCCGAGGGATCTTAGCTCGGTAGCCGACTATGCGGAGCTCTTCAAGAC
CTTGGAAGAGTACCCGGCCAACCTGCAGAAAATGCCCAAGAAGCGGGAGC
TACAACGTACCAACTCAACGCTCCTGCGAGGAGCAGACGAGTCGGTGGCC
ATGGGCATCAACACATCCAACGTTTCGCTGAGTCTGACGCGTCTGGAGGA
GCAGCGCAGTGCCGTGGACGTGTACAATGATTTTAAGGGTTTCCAGCGAA
AGCTGGCCAAGATCTACGACGAGGCAGCCGCTCTGGACACCACAGAATCC
ATATACAAGCAGAAGCTGACGCAGCTCCATGGATTTGCGCAGCAGCTGGA
AAAGCTCATGCCAACCGGCGGTGAGTCTCCGCCAGATGCTTTTACATCCG
AGCAGCAGGAGAAGCTTCTGACCATAGCCGCCAATATGGAACAGCTCAAC
TACCTGCGCTCCAACAGCCTCCAGCTGCCCAATCCCAATGAGATACTCGC
CACCGGGAGTCTTGCCGCTCGCCTGGAGATGTTCGTAGAGGTGCTTACCT
ATACGCTTCTCCAAGTCAGCAGCTACAATATGGCCATGATTTGAAAACCT
CGCTTAAAGAGCTTTAAATACAAATCAAATGTTTAATTTAAAAAAAAAAA
AAAAA

RE47570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
msd5-RA 853 msd5-RA 8..847 1..840 4200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1331817..1332655 839..1 4000 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1332306..1333145 840..1 4200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1332306..1333145 840..1 4200 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:41:01 has no hits.

RE47570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:42:05 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1331825..1332655 1..831 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:19 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
CG2213-RA 1..762 33..794 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:25 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 1..762 33..794 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:09:04 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 1..762 33..794 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:37 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
CG2213-RA 1..762 33..794 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:52 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 1..762 33..794 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:24 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
CG2213-RA 8..846 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:25 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 8..846 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:09:04 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 2..840 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:37 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
CG2213-RA 8..846 1..839 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:52 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
msd5-RA 2..840 1..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:05 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1332307..1333145 1..839 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:05 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1332307..1333145 1..839 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:05 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1332307..1333145 1..839 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:09:04 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1332307..1333145 1..839 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:00 Download gff for RE47570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1332307..1333145 1..839 100   Minus

RE47570.pep Sequence

Translation from 32 to 793

> RE47570.pep
METNVDFSSISSKLYRKYAQHVRNLKDVCVSKTVMKPGAFFDSLQQMMEE
EAAATTPPRDLSSVADYAELFKTLEEYPANLQKMPKKRELQRTNSTLLRG
ADESVAMGINTSNVSLSLTRLEEQRSAVDVYNDFKGFQRKLAKIYDEAAA
LDTTESIYKQKLTQLHGFAQQLEKLMPTGGESPPDAFTSEQQEKLLTIAA
NMEQLNYLRSNSLQLPNPNEILATGSLAARLEMFVEVLTYTLLQVSSYNM
AMI*

RE47570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10063-PA 256 GF10063-PA 1..256 1..253 945 71.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14607-PA 252 GG14607-PA 1..252 1..253 1214 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16229-PA 211 GH16229-PA 1..211 35..251 465 46.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
msd5-PA 253 CG2213-PA 1..253 1..253 1260 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13375-PA 247 GI13375-PA 1..244 1..248 540 48.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16072-PA 183 GL16072-PA 1..139 1..151 427 55.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28478-PA 239 GA28478-PA 1..239 1..251 777 57.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14220-PA 253 GM14220-PA 1..253 1..253 1330 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13483-PA 253 GD13483-PA 1..253 1..253 1324 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13205-PA 249 GJ13205-PA 1..247 1..249 579 45.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25456-PA 256 GK25456-PA 7..255 3..247 455 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20967-PA 253 GE20967-PA 1..253 1..253 1252 92.5 Plus

RE47570.hyp Sequence

Translation from 32 to 793

> RE47570.hyp
METNVDFSSISSKLYRKYAQHVRNLKDVCVSKTVMKPGAFFDSLQQMMEE
EAAATTPPRDLSSVADYAELFKTLEEYPANLQKMPKKRELQRTNSTLLRG
ADESVAMGINTSNVSLSLTRLEEQRSAVDVYNDFKGFQRKLAKIYDEAAA
LDTTESIYKQKLTQLHGFAQQLEKLMPTGGESPPDAFTSEQQEKLLTIAA
NMEQLNYLRSNSLQLPNPNEILATGSLAARLEMFVEVLTYTLLQVSSYNM
AMI*

RE47570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
msd5-PA 253 CG2213-PA 1..253 1..253 1260 100 Plus