Clone RE47768 Report

Search the DGRC for RE47768

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:477
Well:68
Vector:pFlc-1
Associated Gene/TranscripteIF-5A-RA
Protein status:RE47768.pep: gold
Preliminary Size:764
Sequenced Size:794

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3186 2001-12-14 Blastp of sequenced clone
CG3186 2002-01-01 Sim4 clustering to Release 2
CG3186 2003-01-01 Sim4 clustering to Release 3
eIF-5A 2008-04-29 Release 5.5 accounting
eIF-5A 2008-08-15 Release 5.9 accounting
eIF-5A 2008-12-18 5.12 accounting

Clone Sequence Records

RE47768.complete Sequence

794 bp (794 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071396

> RE47768.complete
AATCAAAACGTGGGTTTGATTCGATAGCAGGGTTCTTTCATTTTACATCT
TCGGTTGGAACAGTCACTGGACTTTGCAAGTAGATATGGCTGAGTTGGAC
GATCAATTCGAGACCACGGATTCCGGCGCATCGACGACCTATCCCATGCA
ATGTTCGGCATTGCGCAAAAACGGATTCGTCATGCTGAAGTCGCGGCCAT
GCAAGATTGTCGAGATGTCTACTTCAAAGACTGGAAAGCACGGACACGCC
AAGGTTCATATGGTTGGCATTGATATTTTCTCTAACAAGAAATATGAAGA
TATTTGCCCATCTACTCATAACATGGATGTGCCCAATGTCAAAAGGGAGG
ACCTTCAGTTGATTGCTATTAGTGACGATAGCTTCCTTACATTGATGACC
GAGAGCGGAGATCTGCGTGAAGACTTGAAGGTTCCAGAGGGCGAATTGGG
TGAACAATTGCGTTTAGATTTTGATAGTGGCAAGGACTTACTGTGCACCG
TTCTCAAGGCGTGCGGAGAGGAGTGCGTTATCGCAATTAAAACCAATACT
GCTCTGGACAAATAGGCAAAATGTGTCGCTGTAAATTTCTGTTGCATTTA
CATCTGAAACAAATTTATTCAAAGATGCTGTTATAGGCTAGTTGGCTCTA
CATCTTAAATCTGGTTCTAACGATTGTAATTAATATAACAGAAACTCGAA
GCATCATGTTTGAATAACTAAGTAACAAGATACACGTTTGCCAATAAAAT
TTTTTACCTAAACGTCATCCGTAAAACCAAAAAAAAAAAAAAAA

RE47768.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-5A.a 1344 eIF-5A.a 122..895 4..777 3870 100 Plus
eIF-5A-RA 901 eIF-5A-RA 122..895 4..777 3870 100 Plus
eIF-5A.b 1361 eIF-5A.b 122..895 4..777 3870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19945236..19945520 493..777 1425 100 Plus
chr2R 21145070 chr2R 19944510..19944719 82..291 1020 99 Plus
chr2R 21145070 chr2R 19944973..19945174 292..493 1010 100 Plus
chr2R 21145070 chr2R 19943859..19943938 4..83 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24059195..24059479 493..777 1425 100 Plus
2R 25286936 2R 24058482..24058691 82..291 1050 100 Plus
2R 25286936 2R 24058932..24059133 292..493 1010 100 Plus
2R 25286936 2R 24057827..24057906 4..83 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24060394..24060678 493..777 1425 100 Plus
2R 25260384 2R 24059681..24059890 82..291 1050 100 Plus
2R 25260384 2R 24060131..24060332 292..493 1010 100 Plus
2R 25260384 2R 24059026..24059105 4..83 400 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:16:27 has no hits.

RE47768.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:17:06 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19943856..19943938 1..83 98 -> Plus
chr2R 19944512..19944719 84..291 99 -> Plus
chr2R 19944973..19945174 292..493 100 -> Plus
chr2R 19945237..19945520 494..778 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:19:24 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..480 86..565 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:03 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..480 86..565 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:12 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RB 1..480 86..565 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:38 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..480 86..565 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:16 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RB 1..480 86..565 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:24 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..777 1..777 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:03 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..777 1..777 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:12 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..748 30..778 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:38 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..777 1..777 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:16 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-5A-RA 1..748 30..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:17:06 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24057824..24057906 1..83 98 -> Plus
2R 24058484..24058691 84..291 100 -> Plus
2R 24058932..24059133 292..493 100 -> Plus
2R 24059196..24059479 494..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:17:06 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24057824..24057906 1..83 98 -> Plus
2R 24058484..24058691 84..291 100 -> Plus
2R 24058932..24059133 292..493 100 -> Plus
2R 24059196..24059479 494..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:17:06 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24057824..24057906 1..83 98 -> Plus
2R 24058484..24058691 84..291 100 -> Plus
2R 24058932..24059133 292..493 100 -> Plus
2R 24059196..24059479 494..778 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:12 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19945347..19945429 1..83 98 -> Plus
arm_2R 19946007..19946214 84..291 100 -> Plus
arm_2R 19946455..19946656 292..493 100 -> Plus
arm_2R 19946719..19947002 494..778 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:37 Download gff for RE47768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24060413..24060696 494..778 99   Plus
2R 24059041..24059123 1..83 98 -> Plus
2R 24059701..24059908 84..291 100 -> Plus
2R 24060149..24060350 292..493 100 -> Plus

RE47768.pep Sequence

Translation from 85 to 564

> RE47768.pep
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTG
KHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSF
LTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIA
IKTNTALDK*

RE47768.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11363-PA 160 GF11363-PA 5..160 4..159 783 94.2 Plus
Dana\GF24886-PA 160 GF24886-PA 1..160 1..159 683 79.4 Plus
Dana\GF19751-PA 56 GF19751-PA 1..56 104..159 236 85.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22930-PA 159 GG22930-PA 1..159 1..159 794 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23964-PA 160 GH23964-PA 7..160 6..159 679 80.5 Plus
Dgri\GH15450-PA 160 GH15450-PA 1..160 1..159 651 75.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
eEF5-PA 159 CG3186-PA 1..159 1..159 827 100 Plus
eEF5-PB 159 CG3186-PB 1..159 1..159 827 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16732-PA 159 GI16732-PA 1..159 1..159 688 80.5 Plus
Dmoj\GI14044-PA 156 GI14044-PA 10..156 13..159 648 82.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11658-PA 159 GL11658-PA 1..159 1..159 763 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16529-PA 159 GA16529-PA 1..159 1..159 763 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18297-PA 159 GM18297-PA 1..159 1..159 797 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11829-PA 159 GD11829-PA 1..159 1..159 792 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12476-PA 160 GJ12476-PA 1..160 1..159 656 76.9 Plus
Dvir\GJ13513-PA 159 GJ13513-PA 12..159 12..159 644 79.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21925-PA 161 GK21925-PA 1..161 1..159 722 83.9 Plus
Dwil\GK10602-PA 54 GK10602-PA 1..50 1..48 167 68 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\eIF-5A-PA 159 GE14367-PA 1..159 1..159 798 93.7 Plus

RE47768.hyp Sequence

Translation from 85 to 564

> RE47768.hyp
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTG
KHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSF
LTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIA
IKTNTALDK*

RE47768.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-5A-PA 159 CG3186-PA 1..159 1..159 827 100 Plus
eIF-5A-PB 159 CG3186-PB 1..159 1..159 827 100 Plus