![]() | BDGP Sequence Production Resources |
Search the DGRC for RE47768
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 477 |
Well: | 68 |
Vector: | pFlc-1 |
Associated Gene/Transcript | eIF-5A-RA |
Protein status: | RE47768.pep: gold |
Preliminary Size: | 764 |
Sequenced Size: | 794 |
Gene | Date | Evidence |
---|---|---|
CG3186 | 2001-12-14 | Blastp of sequenced clone |
CG3186 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3186 | 2003-01-01 | Sim4 clustering to Release 3 |
eIF-5A | 2008-04-29 | Release 5.5 accounting |
eIF-5A | 2008-08-15 | Release 5.9 accounting |
eIF-5A | 2008-12-18 | 5.12 accounting |
794 bp (794 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071396
> RE47768.complete AATCAAAACGTGGGTTTGATTCGATAGCAGGGTTCTTTCATTTTACATCT TCGGTTGGAACAGTCACTGGACTTTGCAAGTAGATATGGCTGAGTTGGAC GATCAATTCGAGACCACGGATTCCGGCGCATCGACGACCTATCCCATGCA ATGTTCGGCATTGCGCAAAAACGGATTCGTCATGCTGAAGTCGCGGCCAT GCAAGATTGTCGAGATGTCTACTTCAAAGACTGGAAAGCACGGACACGCC AAGGTTCATATGGTTGGCATTGATATTTTCTCTAACAAGAAATATGAAGA TATTTGCCCATCTACTCATAACATGGATGTGCCCAATGTCAAAAGGGAGG ACCTTCAGTTGATTGCTATTAGTGACGATAGCTTCCTTACATTGATGACC GAGAGCGGAGATCTGCGTGAAGACTTGAAGGTTCCAGAGGGCGAATTGGG TGAACAATTGCGTTTAGATTTTGATAGTGGCAAGGACTTACTGTGCACCG TTCTCAAGGCGTGCGGAGAGGAGTGCGTTATCGCAATTAAAACCAATACT GCTCTGGACAAATAGGCAAAATGTGTCGCTGTAAATTTCTGTTGCATTTA CATCTGAAACAAATTTATTCAAAGATGCTGTTATAGGCTAGTTGGCTCTA CATCTTAAATCTGGTTCTAACGATTGTAATTAATATAACAGAAACTCGAA GCATCATGTTTGAATAACTAAGTAACAAGATACACGTTTGCCAATAAAAT TTTTTACCTAAACGTCATCCGTAAAACCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19945236..19945520 | 493..777 | 1425 | 100 | Plus |
chr2R | 21145070 | chr2R | 19944510..19944719 | 82..291 | 1020 | 99 | Plus |
chr2R | 21145070 | chr2R | 19944973..19945174 | 292..493 | 1010 | 100 | Plus |
chr2R | 21145070 | chr2R | 19943859..19943938 | 4..83 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24059195..24059479 | 493..777 | 1425 | 100 | Plus |
2R | 25286936 | 2R | 24058482..24058691 | 82..291 | 1050 | 100 | Plus |
2R | 25286936 | 2R | 24058932..24059133 | 292..493 | 1010 | 100 | Plus |
2R | 25286936 | 2R | 24057827..24057906 | 4..83 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24060394..24060678 | 493..777 | 1425 | 100 | Plus |
2R | 25260384 | 2R | 24059681..24059890 | 82..291 | 1050 | 100 | Plus |
2R | 25260384 | 2R | 24060131..24060332 | 292..493 | 1010 | 100 | Plus |
2R | 25260384 | 2R | 24059026..24059105 | 4..83 | 400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19943856..19943938 | 1..83 | 98 | -> | Plus |
chr2R | 19944512..19944719 | 84..291 | 99 | -> | Plus |
chr2R | 19944973..19945174 | 292..493 | 100 | -> | Plus |
chr2R | 19945237..19945520 | 494..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..480 | 86..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..480 | 86..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RB | 1..480 | 86..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..480 | 86..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RB | 1..480 | 86..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..777 | 1..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..777 | 1..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..748 | 30..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..777 | 1..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-5A-RA | 1..748 | 30..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24057824..24057906 | 1..83 | 98 | -> | Plus |
2R | 24058484..24058691 | 84..291 | 100 | -> | Plus |
2R | 24058932..24059133 | 292..493 | 100 | -> | Plus |
2R | 24059196..24059479 | 494..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24057824..24057906 | 1..83 | 98 | -> | Plus |
2R | 24058484..24058691 | 84..291 | 100 | -> | Plus |
2R | 24058932..24059133 | 292..493 | 100 | -> | Plus |
2R | 24059196..24059479 | 494..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24057824..24057906 | 1..83 | 98 | -> | Plus |
2R | 24058484..24058691 | 84..291 | 100 | -> | Plus |
2R | 24058932..24059133 | 292..493 | 100 | -> | Plus |
2R | 24059196..24059479 | 494..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19945347..19945429 | 1..83 | 98 | -> | Plus |
arm_2R | 19946007..19946214 | 84..291 | 100 | -> | Plus |
arm_2R | 19946455..19946656 | 292..493 | 100 | -> | Plus |
arm_2R | 19946719..19947002 | 494..778 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24060413..24060696 | 494..778 | 99 | Plus | |
2R | 24059041..24059123 | 1..83 | 98 | -> | Plus |
2R | 24059701..24059908 | 84..291 | 100 | -> | Plus |
2R | 24060149..24060350 | 292..493 | 100 | -> | Plus |
Translation from 85 to 564
> RE47768.pep MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTG KHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSF LTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIA IKTNTALDK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11363-PA | 160 | GF11363-PA | 5..160 | 4..159 | 783 | 94.2 | Plus |
Dana\GF24886-PA | 160 | GF24886-PA | 1..160 | 1..159 | 683 | 79.4 | Plus |
Dana\GF19751-PA | 56 | GF19751-PA | 1..56 | 104..159 | 236 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22930-PA | 159 | GG22930-PA | 1..159 | 1..159 | 794 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23964-PA | 160 | GH23964-PA | 7..160 | 6..159 | 679 | 80.5 | Plus |
Dgri\GH15450-PA | 160 | GH15450-PA | 1..160 | 1..159 | 651 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
eEF5-PA | 159 | CG3186-PA | 1..159 | 1..159 | 827 | 100 | Plus |
eEF5-PB | 159 | CG3186-PB | 1..159 | 1..159 | 827 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16732-PA | 159 | GI16732-PA | 1..159 | 1..159 | 688 | 80.5 | Plus |
Dmoj\GI14044-PA | 156 | GI14044-PA | 10..156 | 13..159 | 648 | 82.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11658-PA | 159 | GL11658-PA | 1..159 | 1..159 | 763 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16529-PA | 159 | GA16529-PA | 1..159 | 1..159 | 763 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18297-PA | 159 | GM18297-PA | 1..159 | 1..159 | 797 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11829-PA | 159 | GD11829-PA | 1..159 | 1..159 | 792 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12476-PA | 160 | GJ12476-PA | 1..160 | 1..159 | 656 | 76.9 | Plus |
Dvir\GJ13513-PA | 159 | GJ13513-PA | 12..159 | 12..159 | 644 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21925-PA | 161 | GK21925-PA | 1..161 | 1..159 | 722 | 83.9 | Plus |
Dwil\GK10602-PA | 54 | GK10602-PA | 1..50 | 1..48 | 167 | 68 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\eIF-5A-PA | 159 | GE14367-PA | 1..159 | 1..159 | 798 | 93.7 | Plus |
Translation from 85 to 564
> RE47768.hyp MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTG KHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSF LTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIA IKTNTALDK*