Clone RE49262 Report

Search the DGRC for RE49262

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:492
Well:62
Vector:pFlc-1
Associated Gene/TranscriptCG14356-RA
Protein status:RE49262.pep: gold
Preliminary Size:638
Sequenced Size:753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14356 2001-12-16 Blastp of sequenced clone
CG14356 2002-01-01 Sim4 clustering to Release 2
CG14356 2003-01-01 Sim4 clustering to Release 3
CG14356 2008-04-29 Release 5.5 accounting
CG14356 2008-08-15 Release 5.9 accounting
CG14356 2008-12-18 5.12 accounting

Clone Sequence Records

RE49262.complete Sequence

753 bp (753 high quality bases) assembled on 2001-12-16

GenBank Submission: AY071405

> RE49262.complete
AGTCTGCTTCTGACATTCGCGCGCCGCGCTCGATCGCCGCTTTTAACGTC
TGTGATACTCCGTTGCTATTGGCCAAAAAGGGCCAAAGTGCCGACAAGCG
AAGCAAAGCGGCTTAGGTTCAAAAATAAATATATATATAGCTATATATTT
CTTCGATTTTCGTGGAGCGAACTTGAGCTGGGATTTTAGCAAACGCAATG
AAAACGATAAAACACACAATCGGCTTCCTACTGCTGGCAGCTTACCTTCC
TTGCATGTCCTGGGCAGCTCCTGCCCTGCACTTCAGTGACCCAGAGCCCG
ATGAACTGGAGGCCTATCCCACGTCGCCCAGTCAGGTGTTGCCCATACAA
CCCGTGTTGATTTACCCCAAGCCACGTGAGAATCTCTACCAGGCGCGAAC
TTTAGCTGGACGAAATGACGACCAGGACATCATCTTTGTGAAGCTGCTGC
AGGATAAGTCCCATGGCTATCGGCCCAAGCAGCAACGTCTCGTCATGGAG
GAGACGAAGTCCTCGCAGCGCAAAAATCTCGGCCTAAAGGACATATTCTA
TGTGAAGGCGCTCACCAACGGACGATTTAGCCATGAGCGACTGAAGGTTT
ACCGGGTGCCCGAGTTCTACGCCATCAGTGTTTTTAGCAACGGTGATAAA
TGAGCAGAGACACCGGTTGTTGGCGATAAAAAAGGAGTAAAATAAGTTAT
TTTTAAGATGCTATAAATAAATACCTCAGGCGTGCCCAAAAAAAAAAAAA
AAA

RE49262.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14356-RA 853 CG14356-RA 1..739 1..739 3695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9955534..9956065 737..206 2585 99.1 Minus
chr3R 27901430 chr3R 9956717..9956926 210..1 1005 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14130678..14131211 739..206 2670 100 Minus
3R 32079331 3R 14131860..14132069 210..1 1035 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13871509..13872042 739..206 2670 100 Minus
3R 31820162 3R 13872691..13872900 210..1 1035 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 14:08:49 has no hits.

RE49262.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:45 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9955534..9956064 207..737 99 <- Minus
chr3R 9956721..9956926 1..206 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:03 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..456 198..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:24 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..456 198..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:49:49 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..456 198..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:36 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..456 198..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:57 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..456 198..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:50 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..737 1..737 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:24 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..737 1..737 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:49:49 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..737 1..737 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:37 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 1..737 1..737 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:57 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
CG14356-RA 4..740 1..737 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:45 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14130680..14131210 207..737 100 <- Minus
3R 14131864..14132069 1..206 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:45 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14130680..14131210 207..737 100 <- Minus
3R 14131864..14132069 1..206 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:45 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14130680..14131210 207..737 100 <- Minus
3R 14131864..14132069 1..206 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:49:49 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9956402..9956932 207..737 100 <- Minus
arm_3R 9957586..9957791 1..206 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:23 Download gff for RE49262.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13871511..13872041 207..737 100 <- Minus
3R 13872695..13872900 1..206 100   Minus

RE49262.pep Sequence

Translation from 197 to 652

> RE49262.pep
MKTIKHTIGFLLLAAYLPCMSWAAPALHFSDPEPDELEAYPTSPSQVLPI
QPVLIYPKPRENLYQARTLAGRNDDQDIIFVKLLQDKSHGYRPKQQRLVM
EETKSSQRKNLGLKDIFYVKALTNGRFSHERLKVYRVPEFYAISVFSNGD
K*

RE49262.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18786-PA 150 GF18786-PA 1..150 1..151 662 82.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21470-PA 151 GG21470-PA 1..151 1..151 759 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19696-PA 150 GH19696-PA 9..148 11..151 373 55.7 Plus
Dgri\GH23751-PA 150 GH23751-PA 9..148 11..151 370 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14356-PA 151 CG14356-PA 1..151 1..151 790 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24551-PA 149 GI24551-PA 3..149 5..151 389 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23306-PA 153 GL23306-PA 24..152 21..150 566 85.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12930-PA 136 GA12930-PA 7..135 21..150 562 84.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25882-PA 151 GM25882-PA 1..151 1..151 788 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20452-PA 151 GD20452-PA 1..151 1..151 794 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22618-PA 149 GJ22618-PA 27..149 21..151 411 65.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10905-PA 151 GK10905-PA 14..151 11..151 444 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10057-PA 151 GE10057-PA 1..151 1..151 767 94 Plus

RE49262.hyp Sequence

Translation from 197 to 652

> RE49262.hyp
MKTIKHTIGFLLLAAYLPCMSWAAPALHFSDPEPDELEAYPTSPSQVLPI
QPVLIYPKPRENLYQARTLAGRNDDQDIIFVKLLQDKSHGYRPKQQRLVM
EETKSSQRKNLGLKDIFYVKALTNGRFSHERLKVYRVPEFYAISVFSNGD
K*

RE49262.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14356-PA 151 CG14356-PA 1..151 1..151 790 100 Plus