Clone RE49388 Report

Search the DGRC for RE49388

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:493
Well:88
Vector:pFlc-1
Associated Gene/TranscriptCG8993-RA
Protein status:RE49388.pep: gold
Preliminary Size:484
Sequenced Size:632

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8993 2001-12-16 Blastp of sequenced clone
CG8993 2002-01-01 Sim4 clustering to Release 2
CG8993 2003-01-01 Sim4 clustering to Release 3
CG8993 2008-04-29 Release 5.5 accounting
CG8993 2008-08-15 Release 5.9 accounting
CG8993 2008-12-18 5.12 accounting

Clone Sequence Records

RE49388.complete Sequence

632 bp (632 high quality bases) assembled on 2001-12-16

GenBank Submission: AY071406

> RE49388.complete
ATTGATGTTGTTCTGATTCTCTTGTCATTATTTTGCAATCAATCGCTGAA
CTTTTTGCACTGAGAAATTGTAGAAAATAAGCCATGCAGCGACAGATTAT
TAACATTCTGGGACAGACGACGCGTCGCCTGGCTAGCGGCCAGCAAATTC
GCATGCTGTCAGTTTCTGCGCCGCGACAGGAGATCTTCAAAGTCCAGAGC
GCCGAGGACTTTGACAAGAAAGTAAAGAACAGCCAGCAGCCCGTGATTGT
GGACTTCTTCGCAACCTGGTGCAATCCCTGCAAGCTGCTAACCCCGCGCA
TCGAGAGTATTGTGGGCGAACAGGCCGGTTCCATCAAGCTGGCCAAGGTG
GACATAGATGAGCACAGCGAACTGGCTCTGGACTACGATGTGGCCGCCGT
GCCCGTGCTAGTGGTGCTGCAGAACGGCAAGGAGGTGCAGCGCATGGTGG
GACTCCAGGACGAGGACAAAATCCGGGCCTGGGTTGCCGCCGCCGTCAAA
CAGGCCAAGTAATAATTGAGAAATCCCAAAAAAAAAGTGGAGGTTGACCT
CCTCGCAAATAAAGCTGAGCTTTAGGTTAATTCGGACTTTCGAAATAAAT
GTTTATTTACCCGTTGAAAAAAAAAAAAAAAA

RE49388.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-RA 719 CG8993-RA 95..713 1..619 3080 99.8 Plus
mRpL23-RA 667 mRpL23-RA 586..667 619..538 410 100 Minus
mRpL23-RB 632 mRpL23-RB 587..632 619..574 230 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2371959..2372309 266..616 1680 98.6 Plus
chr3L 24539361 chr3L 2371632..2371896 1..265 1265 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2372526..2372879 266..619 1770 100 Plus
3L 28110227 3L 2372199..2372463 1..265 1310 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2372526..2372879 266..619 1770 100 Plus
3L 28103327 3L 2372199..2372463 1..265 1310 99.6 Plus
Blast to na_te.dros performed on 2019-03-16 14:09:43 has no hits.

RE49388.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:11:05 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2371632..2371896 1..265 98 -> Plus
chr3L 2371959..2372309 266..616 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:03 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 84..512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:28 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 84..512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:51:34 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 84..512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:01 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 84..512 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:11 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 84..512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:51 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..616 1..616 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:28 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..616 1..616 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:51:34 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..616 1..616 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:01 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..616 1..616 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:11 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..616 1..616 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:05 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372199..2372463 1..265 99 -> Plus
3L 2372526..2372876 266..616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:05 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372199..2372463 1..265 99 -> Plus
3L 2372526..2372876 266..616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:05 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372199..2372463 1..265 99 -> Plus
3L 2372526..2372876 266..616 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:51:34 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2372199..2372463 1..265 99 -> Plus
arm_3L 2372526..2372876 266..616 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:57 Download gff for RE49388.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372199..2372463 1..265 99 -> Plus
3L 2372526..2372876 266..616 100   Plus

RE49388.pep Sequence

Translation from 83 to 511

> RE49388.pep
MQRQIINILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNS
QQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALD
YDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQAK*

RE49388.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24914-PA 143 GF24914-PA 1..142 1..142 673 90.8 Plus
Dana\GF11737-PA 138 GF11737-PA 11..129 9..134 362 53.2 Plus
Dana\Trx-2-PA 106 GF22780-PA 2..104 34..132 206 35 Plus
Dana\GF21263-PA 162 GF21263-PA 55..151 37..134 203 37.8 Plus
Dana\TrxT-PA 177 GF20950-PA 2..92 34..123 177 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14861-PA 142 GG14861-PA 1..142 1..142 727 97.9 Plus
Dere\GG21998-PA 145 GG21998-PA 24..137 27..140 360 54.4 Plus
Dere\GG12702-PA 159 GG12702-PA 33..148 17..134 209 36.4 Plus
Dere\Trx-2-PA 106 GG10043-PA 2..104 34..132 197 32 Plus
Dere\GG15694-PA 135 GG15694-PA 1..99 27..123 172 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16478-PA 140 GH16478-PA 1..139 1..142 602 81.7 Plus
Dgri\GH23019-PA 153 GH23019-PA 22..144 8..141 336 47 Plus
Dgri\GH12588-PA 161 GH12588-PA 40..150 23..134 212 35.7 Plus
Dgri\GH14756-PA 133 GH14756-PA 12..112 32..132 203 35.3 Plus
Dgri\Trx-2-PA 106 GH10676-PA 2..92 34..123 189 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-PA 142 CG8993-PA 1..142 1..142 708 100 Plus
CG8517-PA 145 CG8517-PA 11..135 14..138 347 52 Plus
CG3719-PA 160 CG3719-PA 34..149 17..134 208 36.4 Plus
Trx-2-PA 106 CG31884-PA 2..104 34..132 197 35 Plus
Trx-2-PB 106 CG31884-PB 2..104 34..132 197 35 Plus
CG13473-PA 139 CG13473-PA 1..99 27..123 186 32.3 Plus
TrxT-PB 157 CG3315-PB 2..96 34..127 171 25.3 Plus
TrxT-PA 157 CG3315-PA 2..96 34..127 171 25.3 Plus
dhd-PB 107 CG4193-PB 4..106 37..139 158 30.8 Plus
dhd-PA 107 CG4193-PA 4..106 37..139 158 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21084-PA 144 GI21084-PA 26..135 32..141 322 44.5 Plus
Dmoj\GI11498-PA 162 GI11498-PA 12..108 32..127 208 38.1 Plus
Dmoj\Trx-2-PA 106 GI11084-PA 2..92 34..123 195 34.1 Plus
Dmoj\TrxT-PA 165 GI11058-PA 5..92 37..123 180 34.1 Plus
Dmoj\GI14472-PA 106 GI14472-PA 4..106 37..139 162 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24652-PA 143 GL24652-PA 1..142 1..142 647 85.9 Plus
Dper\GL24554-PA 141 GL24554-PA 5..102 31..127 207 33.7 Plus
Dper\GL14382-PA 161 GL14382-PA 40..150 23..134 200 34.8 Plus
Dper\TrxT-PA 167 GL14330-PA 2..96 34..127 194 35.8 Plus
Dper\dhd-PA 106 GL14288-PA 4..97 37..130 142 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21460-PA 143 GA21460-PA 1..142 1..142 647 85.9 Plus
Dpse\GA12311-PA 141 GA12311-PA 5..102 31..127 207 33.7 Plus
Dpse\GA17639-PA 161 GA17639-PA 40..150 23..134 200 34.8 Plus
Dpse\Trx-2-PA 106 GA16546-PA 2..104 34..132 195 32 Plus
Dpse\TrxT-PA 167 GA17324-PA 2..96 34..127 192 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14486-PA 142 GM14486-PA 1..142 1..142 734 99.3 Plus
Dsec\GM21982-PA 145 GM21982-PA 24..137 27..140 361 55.3 Plus
Dsec\GM23203-PA 145 GM23203-PA 24..137 27..140 361 55.3 Plus
Dsec\Trx-2-PA 106 GM17580-PA 2..104 34..132 202 35 Plus
Dsec\GM25478-PA 139 GM25478-PA 1..106 27..122 187 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13682-PA 142 GD13682-PA 1..142 1..142 734 99.3 Plus
Dsim\GD11480-PA 145 GD11480-PA 24..137 27..140 361 55.3 Plus
Dsim\GD16424-PA 159 GD16424-PA 38..148 23..134 211 35.7 Plus
Dsim\Trx-2-PA 106 GD23618-PA 2..104 34..132 202 35 Plus
Dsim\GD14500-PA 139 GD14500-PA 1..106 27..122 187 32.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13429-PA 141 GJ13429-PA 1..140 1..142 620 82.4 Plus
Dvir\GJ20933-PA 105 GJ20933-PA 2..102 41..141 325 53.5 Plus
Dvir\GJ13693-PA 162 GJ13693-PA 12..112 32..132 216 37.3 Plus
Dvir\GJ15909-PA 161 GJ15909-PA 40..150 23..134 210 36.6 Plus
Dvir\Trx-2-PA 106 GJ18315-PA 2..92 34..123 196 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12639-PA 141 GK12639-PA 1..140 1..142 617 83.9 Plus
Dwil\GK15891-PA 145 GK15891-PA 4..139 6..141 367 48.5 Plus
Dwil\GK16685-PA 161 GK16685-PA 54..150 37..134 206 37.8 Plus
Dwil\GK10532-PA 176 GK10532-PA 7..103 32..127 195 32 Plus
Dwil\Trx-2-PA 106 GK23868-PA 2..92 34..123 192 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20317-PA 142 GE20317-PA 1..142 1..142 726 97.9 Plus
Dyak\GE12078-PA 145 GE12078-PA 3..137 12..140 366 51.1 Plus
Dyak\GE16531-PA 159 GE16531-PA 33..148 17..134 215 37.3 Plus
Dyak\GE22025-PA 132 GE22025-PA 5..99 31..123 179 32.6 Plus
Dyak\TrxT-PA 157 GE16820-PA 2..96 34..127 171 29.5 Plus

RE49388.hyp Sequence

Translation from 83 to 511

> RE49388.hyp
MQRQIINILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNS
QQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALD
YDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQAK*

RE49388.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-PA 142 CG8993-PA 1..142 1..142 708 100 Plus
CG8517-PA 145 CG8517-PA 11..135 14..138 347 52 Plus
CG3719-PA 160 CG3719-PA 34..149 17..134 208 36.4 Plus
Trx-2-PA 106 CG31884-PA 2..104 34..132 197 35 Plus
Trx-2-PB 106 CG31884-PB 2..104 34..132 197 35 Plus