Clone RE49489 Report

Search the DGRC for RE49489

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:494
Well:89
Vector:pFlc-1
Associated Gene/Transcriptp24-1-RA
Protein status:RE49489.pep: gold
Preliminary Size:953
Sequenced Size:1101

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1967 2001-12-14 Blastp of sequenced clone
CG1967 2002-01-01 Sim4 clustering to Release 2
CG1967 2003-01-01 Sim4 clustering to Release 3
p24-1 2008-04-29 Release 5.5 accounting
p24-1 2008-08-15 Release 5.9 accounting
p24-1 2008-12-18 5.12 accounting

Clone Sequence Records

RE49489.complete Sequence

1101 bp (1101 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071410

> RE49489.complete
ATCGTGCGGCGAATAACACAAAACGCCGAATGCTGGCGATATCGATAGCA
TATCACAAATAACAAAAACACGTCACGTAATCCGGACGGAGGCTGCTGGA
AGAATAACAGGCGGTGAAGCAGGGAATCATACGAATCCAGCAGGGAATAC
CAAAAAGCAAAAAGGGCGAACCATGAACACACAAATCGTTGTATTTGCGG
TAGCTCTGATGATGCACTGCATCTCTGCCGTCGAATTCACCTTCGATCTG
GCCGATAACGCGGTGGATTGCTTCTACGAGGAGATCAAGAAGAACTCGAG
CGCCTACTTTGAGTTCCAGGTGTCGGCCGGTGGCCAATTGGACGTGGACG
TCACCCTGAAGGATCCGCAGGGCAAGGTCATCTACAGTCTGGAGAAGGCC
ACCTTCGATAGTCATCAGTTCGTTGCCGAGACAACGGGCGTGTATACCGC
TTGCTTTGGCAATCAATTCTCGGCCTTCTCGCACAAGATCGTCTACGTGG
ACTTCCAAGTGGGCGAGGAGCCGGCTCTGCCCGGTGTGGATGAACATGCC
ACGGTGCTCACACAGATGGAGACATCGTCGCAGGCGATTCACAAGGGCCT
CAACGACATCCTGGACGCCCAGACGCATCATCGACTGAGGGAGGCGCAAG
GTCGCAAGCGGGCCGAAGATCTCAATCAGCGGGTTATGGTCTGGTCATCC
CTGGAGACGGCCGCAGTCATCGTGATCGGTCTCGTCCAGATTATGGTGCT
GAGGAACTTCTTTACGGACCGAAAGCCCAGCCAGGCACACTACGGGCGGC
TGTAGAGGATCAGGTTTCATTTTGGGATCTAGCTTAGTTCAGAGCCCTCG
GATGGAGAGGGTCTCCTCCAATACCCAACTGTCCAAATCCCCCGAAATGT
TGTCAATCTCGTCTTAGCCACAACGTATTCATTACCCCCCCCCCCCTCAA
GGGCGTTTCTTTTTCGGGCAAAAAAAACTCCCTAAACGACACATGTAATA
TTTTTTGTTAAGACCCCTCCCGGTAAAATACATAAAAAGGCCAGAAAATA
CATTAAAAAAAAACCAGAACTCGATAGCTAAAGGTAAAAAAAAAAAAAAA
A

RE49489.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
p24-1-RA 1613 p24-1-RA 109..1195 1..1086 5395 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11742479..11743469 1085..95 4845 99.7 Minus
chrX 22417052 chrX 11743550..11743644 95..1 460 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11851348..11852340 1086..95 4915 99.9 Minus
X 23542271 X 11852421..11852515 95..1 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11859446..11860438 1086..95 4925 99.8 Minus
X 23527363 X 11860519..11860613 95..1 475 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:30:38 has no hits.

RE49489.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:31:36 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11742479..11743468 96..1085 99 <- Minus
chrX 11743550..11743644 1..95 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:11 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..633 173..805 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:37 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..633 173..805 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:25:24 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..633 173..805 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:48 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..633 173..805 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:55 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..633 173..805 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:34 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..1086 1..1085 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:37 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..1086 1..1085 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:25:24 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 16..1101 1..1085 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:48 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 1..1086 1..1085 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:55 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
p24-1-RA 16..1101 1..1085 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:36 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
X 11852421..11852515 1..95 100   Minus
X 11851349..11852339 96..1085 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:36 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
X 11852421..11852515 1..95 100   Minus
X 11851349..11852339 96..1085 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:36 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
X 11852421..11852515 1..95 100   Minus
X 11851349..11852339 96..1085 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:25:24 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11745382..11746372 96..1085 99 <- Minus
arm_X 11746454..11746548 1..95 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:03 Download gff for RE49489.complete
Subject Subject Range Query Range Percent Splice Strand
X 11859447..11860437 96..1085 99 <- Minus
X 11860519..11860613 1..95 100   Minus

RE49489.hyp Sequence

Translation from 172 to 804

> RE49489.hyp
MNTQIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV
SAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFS
AFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQ
THHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDR
KPSQAHYGRL*

RE49489.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
p24-1-PB 210 CG1967-PB 1..210 1..210 1077 100 Plus
p24-1-PA 210 CG1967-PA 1..210 1..210 1077 100 Plus
CHOp24-PB 208 CG3564-PB 7..202 4..197 238 27 Plus
CHOp24-PA 208 CG3564-PA 7..202 4..197 238 27 Plus
opm-PA 242 CG9053-PA 33..227 21..197 194 31.6 Plus

RE49489.pep Sequence

Translation from 172 to 804

> RE49489.pep
MNTQIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV
SAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFS
AFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQ
THHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDR
KPSQAHYGRL*

RE49489.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19411-PA 226 GF19411-PA 30..226 14..210 992 92.4 Plus
Dana\GF19355-PA 208 GF19355-PA 35..206 32..201 229 28.7 Plus
Dana\GF22070-PA 235 GF22070-PA 25..220 21..197 185 30.1 Plus
Dana\GF13282-PA 207 GF13282-PA 32..205 32..201 161 25.3 Plus
Dana\GF23515-PA 237 GF23515-PA 58..236 32..206 161 24 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18829-PA 210 GG18829-PA 1..210 1..210 1095 96.2 Plus
Dere\GG18710-PA 208 GG18710-PA 19..206 16..201 236 27.9 Plus
Dere\GG19424-PA 242 GG19424-PA 33..227 21..197 196 32.5 Plus
Dere\GG17343-PA 216 GG17343-PA 7..214 9..201 162 25.2 Plus
Dere\GG21711-PA 229 GG21711-PA 38..216 32..197 158 28.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11947-PA 238 GH11947-PA 47..238 19..210 920 85.9 Plus
Dgri\GH24063-PA 209 GH24063-PA 36..207 32..201 218 28.7 Plus
Dgri\GH11207-PA 244 GH11207-PA 45..225 31..198 197 29.3 Plus
Dgri\GH11950-PA 209 GH11950-PA 11..194 32..197 191 31 Plus
Dgri\GH18190-PA 216 GH18190-PA 1..214 1..201 162 24.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
p24-1-PB 210 CG1967-PB 1..210 1..210 1077 100 Plus
p24-1-PA 210 CG1967-PA 1..210 1..210 1077 100 Plus
CHOp24-PB 208 CG3564-PB 7..202 4..197 238 27 Plus
CHOp24-PA 208 CG3564-PA 7..202 4..197 238 27 Plus
opm-PA 242 CG9053-PA 33..227 21..197 194 31.6 Plus
opm-PC 242 CG9053-PC 33..227 21..197 194 31.6 Plus
loj-PF 237 CG10733-PF 45..235 19..205 173 22.2 Plus
loj-PE 237 CG10733-PE 45..235 19..205 173 22.2 Plus
loj-PD 237 CG10733-PD 45..235 19..205 173 22.2 Plus
CG31787-PA 232 CG31787-PA 41..219 32..197 170 28.5 Plus
eca-PA 216 CG33104-PA 1..214 1..201 159 24.1 Plus
CG9308-PA 203 CG9308-PA 14..197 18..197 148 24.9 Plus
bai-PA 206 CG11785-PA 6..203 8..201 147 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15363-PA 235 GI15363-PA 24..235 1..210 966 83.5 Plus
Dmoj\GI15191-PA 208 GI15191-PA 35..206 32..201 239 30.2 Plus
Dmoj\GI15367-PA 241 GI15367-PA 45..226 32..197 197 32.8 Plus
Dmoj\GI18130-PA 232 GI18130-PA 40..220 31..198 179 26.5 Plus
Dmoj\GI10144-PA 216 GI10144-PA 1..214 1..201 162 24.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20350-PA 221 GL20350-PA 30..221 19..210 985 93.8 Plus
Dper\GL19967-PA 208 GL19967-PA 35..206 32..201 234 29.9 Plus
Dper\GL26847-PA 238 GL26847-PA 31..223 21..197 205 33.5 Plus
Dper\GL19428-PA 226 GL19428-PA 3..214 4..198 200 30.7 Plus
Dper\GL16969-PA 204 GL16969-PA 30..202 33..201 168 24.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15160-PA 221 GA15160-PA 30..221 19..210 986 93.8 Plus
Dpse\GA28584-PA 208 GA28584-PA 35..206 32..201 231 29.3 Plus
Dpse\GA16477-PA 226 GA16477-PA 3..214 4..198 204 29.9 Plus
Dpse\GA21505-PA 238 GA21505-PA 31..223 21..197 204 33 Plus
Dpse\GA21688-PA 204 GA21688-PA 30..202 33..201 168 24.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13040-PA 159 GM13040-PA 1..159 1..210 718 70 Plus
Dsec\GM12348-PA 208 GM12348-PA 19..206 16..201 233 27.9 Plus
Dsec\GM12010-PA 242 GM12010-PA 33..227 21..197 189 30.3 Plus
Dsec\GM17092-PA 232 GM17092-PA 41..219 32..197 179 29.6 Plus
Dsec\GM26230-PA 216 GM26230-PA 1..214 1..201 161 24.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15965-PA 90 GD15965-PA 1..90 1..90 465 97.8 Plus
Dsim\GD24531-PA 79 GD24531-PA 1..79 132..210 402 94.9 Plus
Dsim\GD16693-PA 208 GD16693-PA 19..206 16..201 233 27.9 Plus
Dsim\GD15824-PA 242 GD15824-PA 33..227 21..197 189 30.3 Plus
Dsim\GD21836-PA 232 GD21836-PA 41..219 32..197 174 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16789-PA 246 GJ16789-PA 55..246 19..210 948 89.1 Plus
Dvir\GJ14798-PA 208 GJ14798-PA 35..206 32..201 225 28.7 Plus
Dvir\GJ16792-PA 242 GJ16792-PA 44..227 32..197 195 31.5 Plus
Dvir\GJ17754-PA 233 GJ17754-PA 41..221 31..198 189 28.7 Plus
Dvir\GJ23362-PA 216 GJ23362-PA 1..214 1..201 164 24.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10123-PA 224 GK10123-PA 15..224 1..210 956 81 Plus
Dwil\GK14515-PA 299 GK14515-PA 126..297 32..201 227 28.7 Plus
Dwil\GK19732-PA 224 GK19732-PA 15..210 21..198 203 28.6 Plus
Dwil\GK17263-PA 241 GK17263-PA 62..240 32..206 167 24.6 Plus
Dwil\GK14577-PA 235 GK14577-PA 43..222 31..197 166 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17592-PA 210 GE17592-PA 1..210 1..210 1104 97.6 Plus
Dyak\GE16348-PA 208 GE16348-PA 7..206 4..201 248 26.7 Plus
Dyak\GE16075-PA 242 GE16075-PA 33..227 21..197 194 32.7 Plus
Dyak\GE24749-PA 216 GE24749-PA 7..214 9..201 161 24.8 Plus
Dyak\GE12735-PA 229 GE12735-PA 38..216 32..197 153 28.2 Plus