Clone RE49565 Report

Search the DGRC for RE49565

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:495
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG5500-RA
Protein status:RE49565.pep: gold
Preliminary Size:706
Sequenced Size:873

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5500 2002-01-01 Sim4 clustering to Release 2
CG5500 2002-11-12 Blastp of sequenced clone
CG5500 2003-01-01 Sim4 clustering to Release 3
CG5500 2008-04-29 Release 5.5 accounting
CG5500 2008-08-15 Release 5.9 accounting
CG5500 2008-12-18 5.12 accounting

Clone Sequence Records

RE49565.complete Sequence

873 bp (873 high quality bases) assembled on 2002-11-12

GenBank Submission: AY075497

> RE49565.complete
AGGGCTGCATTATTGTTTGTTAGTTTTGCTGTTTGGTTTTTAACAAATTT
CCTGGTTTTCCCTCAAAAACCCTCTCTTATATAAATAAATCAAGTGCAAA
ATGCTGAGTCCATAACAACACACTTCCTGCGGAACCAAGTTCATCTGGGC
TGCACCTGCGCAGGCGTGTGAAATGCTCATCACTTCCTCTGGGCCTTTTC
AATCGTAACTTTCGAACTCTTTCGGGGATCGGGCGGAAATGTTGGCTCCC
CTGGGCTTCAGCTGTCCGCGATGCTTGCTCCTGCGACGTGGCGCCGAGCG
TTGGGCCTCACTGGCCCGCCAATTGTCGGGCAGCAGCTCCCAGGATGATG
CCAGCAGCAAGGATGCGGCCGCCCAGGAGGCAGCAAGTGGCTGTCCGCCC
AATAGCACAACGACGGGCACTGACACTCCCAAAGCCAAAGATAAAACCAC
CAAGGGAAGGAAGCGGCTCAGAAACATAGAGATACCTCCCGAGCCCACCA
CCTGCTGCATGTCGGGCTGCGCCAACTGCGTTTGGCTGGACTACGCACAG
ACGCTGGCCAAGCTGCTGGGCGACAACGATGAGGAGGCGCGAGAGATTGT
GCTGAGCAAGATCACCGACCCGAACCTGAAGATGTTCCTCAGCCTGGAGC
TGCGCCAGATGGCTAAGCAGCGGGAGGAGAAGGCGGCGGCGGAGAAAGCA
GCGAAGCAGGGAAAGCCAAAGAAATCCTCGCCCCCGCCGTAGTACAAATC
CCCGCTCACCTAAATATCTAGTTAGGACCAAATTCGTAGTAGCTCAAATT
TACTCTTGTACTTAGTGTGTAAGAACTAAGAAACCTCAAAATAAACATGT
AAGAGTCAAAAAAAAAAAAAAAA

RE49565.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-RA 920 CG5500-RA 22..877 1..856 4280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22703211..22703587 480..856 1885 100 Plus
chr3R 27901430 chr3R 22702607..22702964 124..481 1790 100 Plus
chr3R 27901430 chr3R 22699761..22699883 1..123 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:59:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26880083..26880459 480..856 1885 100 Plus
3R 32079331 3R 26879479..26879836 124..481 1790 100 Plus
3R 32079331 3R 26876633..26876755 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26620914..26621290 480..856 1885 100 Plus
3R 31820162 3R 26620310..26620667 124..481 1790 100 Plus
3R 31820162 3R 26617464..26617586 1..123 615 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:10:13 has no hits.

RE49565.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:11:19 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22702607..22702964 124..481 100 -> Plus
chr3R 22699761..22699883 1..123 100 -> Plus
chr3R 22703213..22703587 482..857 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:17 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 239..742 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:54 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 239..742 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:53:17 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 239..742 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:02 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 239..742 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:30 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 239..742 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:33 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:54 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:53:17 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 4..859 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:02 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:30 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 4..859 1..856 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:19 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26876633..26876755 1..123 100 -> Plus
3R 26879479..26879836 124..481 100 -> Plus
3R 26880085..26880459 482..857 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:19 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26876633..26876755 1..123 100 -> Plus
3R 26879479..26879836 124..481 100 -> Plus
3R 26880085..26880459 482..857 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:19 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26876633..26876755 1..123 100 -> Plus
3R 26879479..26879836 124..481 100 -> Plus
3R 26880085..26880459 482..857 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:53:17 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22702355..22702477 1..123 100 -> Plus
arm_3R 22705201..22705558 124..481 100 -> Plus
arm_3R 22705807..22706181 482..857 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:11:39 Download gff for RE49565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26620310..26620667 124..481 100 -> Plus
3R 26620916..26621290 482..857 99   Plus
3R 26617464..26617586 1..123 100 -> Plus

RE49565.pep Sequence

Translation from 238 to 741

> RE49565.pep
MLAPLGFSCPRCLLLRRGAERWASLARQLSGSSSQDDASSKDAAAQEAAS
GCPPNSTTTGTDTPKAKDKTTKGRKRLRNIEIPPEPTTCCMSGCANCVWL
DYAQTLAKLLGDNDEEAREIVLSKITDPNLKMFLSLELRQMAKQREEKAA
AEKAAKQGKPKKSSPPP*

RE49565.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16461-PA 171 GF16461-PA 1..155 1..144 488 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11508-PA 164 GG11508-PA 1..162 1..166 617 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10459-PA 115 GH10459-PA 40..108 79..147 291 71 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-PA 167 CG5500-PA 1..167 1..167 869 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23053-PA 64 GI23053-PA 1..58 91..148 238 70.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27228-PA 128 GL27228-PA 1..127 1..166 334 54.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18931-PA 128 GA18931-PA 1..127 1..165 339 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10350-PA 167 GM10350-PA 1..167 1..167 831 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21312-PA 167 GD21312-PA 1..167 1..167 715 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24637-PA 114 GJ24637-PA 1..114 1..159 302 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13547-PA 122 GK13547-PA 1..106 1..146 351 51.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23698-PA 165 GE23698-PA 1..163 1..166 656 88.6 Plus

RE49565.hyp Sequence

Translation from 238 to 741

> RE49565.hyp
MLAPLGFSCPRCLLLRRGAERWASLARQLSGSSSQDDASSKDAAAQEAAS
GCPPNSTTTGTDTPKAKDKTTKGRKRLRNIEIPPEPTTCCMSGCANCVWL
DYAQTLAKLLGDNDEEAREIVLSKITDPNLKMFLSLELRQMAKQREEKAA
AEKAAKQGKPKKSSPPP*

RE49565.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-PA 167 CG5500-PA 1..167 1..167 869 100 Plus