BDGP Sequence Production Resources |
Search the DGRC for RE49709
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 497 |
Well: | 9 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Cisd2-RA |
Protein status: | RE49709.pep: gold |
Sequenced Size: | 685 |
Gene | Date | Evidence |
---|---|---|
CG1458 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1458 | 2002-04-04 | Blastp of sequenced clone |
CG1458 | 2003-01-01 | Sim4 clustering to Release 3 |
CG1458 | 2008-04-29 | Release 5.5 accounting |
CG1458 | 2008-08-15 | Release 5.9 accounting |
CG1458 | 2008-12-18 | 5.12 accounting |
685 bp (685 high quality bases) assembled on 2002-04-04
GenBank Submission: AY095084
> RE49709.complete ATCGATTTGCTAGCACCGCTAACCGATAGCAACACAAAAACAAGTTTTCC GAATTTAATAGCCAGTTAAATAAAAAAGGCGTTTCGAAATGGAGCCCATA TCACATCTGGTGAAGTCCTCGCTGCCCAATTACTTGTCAAGTCTGCCGGT TCCCGACAGCATCGGCGGCTGGTTTAAGCTCTCCTTCAAGGATTGGTTGG CCCTGATCCCACCCACCGTGGTGGTGGCCGGACTCGGCTACACCGCCTAC CTGGCCTACTGTCCGGCGGCACGGGCCAGCTGCGCGGCCAAAAACAGCGG ACGCTGCAACAACCACATCCGCAAGAACGAGCCCAAGGTGGTGGACATGA TCGACGTGGAGGATATTGCGGAGAAGGCGGCCTTCTGTCGCTGCTGGAAG ACCAAGAACTGGCCCTACTGCGATGGCAGTCATGGCGAGCACAACAAGCA GACTGGAGACAACGTCGGACCAATTGTCATCAAGAAGTAGATTGCGGCGG TGCATCGATACACAAACGTTCTAGCATTTCCTCTCGCTGAGCTCCAGTTT GCTTTTAAAACCAATAGTAGTGGCCGAAGCTGTTTGAACCCTTGTAATTG TAAGCAATAATTGATGATATTGATGGATTAAGTTAAAAGGAGCCAATAAA ATTGCCCAAACATAAATCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1458-RA | 789 | CG1458-RA | 25..696 | 1..672 | 3345 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25044983..25045240 | 667..410 | 1290 | 100 | Minus |
chr3R | 27901430 | chr3R | 25045305..25045528 | 409..186 | 1120 | 100 | Minus |
chr3R | 27901430 | chr3R | 25046002..25046186 | 185..1 | 925 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29222219..29222481 | 672..410 | 1300 | 99.6 | Minus |
3R | 32079331 | 3R | 29222546..29222769 | 409..186 | 1120 | 100 | Minus |
3R | 32079331 | 3R | 29223243..29223427 | 185..1 | 925 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 28963050..28963312 | 672..410 | 1300 | 99.6 | Minus |
3R | 31820162 | 3R | 28963377..28963600 | 409..186 | 1120 | 100 | Minus |
3R | 31820162 | 3R | 28964074..28964258 | 185..1 | 925 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pogo | 2121 | pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). | 131..181 | 640..590 | 110 | 73.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25044981..25045240 | 410..669 | 99 | <- | Minus |
chr3R | 25045305..25045528 | 186..409 | 100 | <- | Minus |
chr3R | 25046002..25046186 | 1..185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..402 | 89..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..402 | 89..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..402 | 89..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..402 | 89..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cisd2-RA | 1..402 | 89..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..669 | 1..669 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..669 | 1..669 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 2..670 | 1..669 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1458-RA | 1..669 | 1..669 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cisd2-RA | 2..670 | 1..669 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29222222..29222481 | 410..669 | 99 | <- | Minus |
3R | 29222546..29222769 | 186..409 | 100 | <- | Minus |
3R | 29223243..29223427 | 1..185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29222222..29222481 | 410..669 | 99 | <- | Minus |
3R | 29222546..29222769 | 186..409 | 100 | <- | Minus |
3R | 29223243..29223427 | 1..185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29222222..29222481 | 410..669 | 99 | <- | Minus |
3R | 29222546..29222769 | 186..409 | 100 | <- | Minus |
3R | 29223243..29223427 | 1..185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25047944..25048203 | 410..669 | 99 | <- | Minus |
arm_3R | 25048268..25048491 | 186..409 | 100 | <- | Minus |
arm_3R | 25048965..25049149 | 1..185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 28963053..28963312 | 410..669 | 99 | <- | Minus |
3R | 28963377..28963600 | 186..409 | 100 | <- | Minus |
3R | 28964074..28964258 | 1..185 | 100 | Minus |
Translation from 88 to 489
> RE49709.pep MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLG YTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFC RCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16608-PA | 134 | GF16608-PA | 1..133 | 1..133 | 621 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12028-PA | 133 | GG12028-PA | 1..133 | 1..133 | 682 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14305-PA | 132 | GH14305-PA | 1..130 | 1..133 | 621 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cisd2-PA | 133 | CG1458-PA | 1..133 | 1..133 | 733 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10402-PA | 131 | GI10402-PA | 1..130 | 1..133 | 566 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13882-PA | 132 | GL13882-PA | 1..131 | 1..133 | 627 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13095-PA | 132 | GA13095-PA | 1..131 | 1..133 | 627 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12252-PA | 133 | GM12252-PA | 1..133 | 1..133 | 690 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17906-PA | 133 | GD17906-PA | 1..133 | 1..133 | 690 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14516-PA | 133 | GJ14516-PA | 1..132 | 1..133 | 536 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22673-PA | 134 | GK22673-PA | 1..134 | 1..133 | 628 | 85.8 | Plus |
Dwil\GK20216-PA | 152 | GK20216-PA | 1..133 | 1..132 | 567 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10465-PA | 133 | GE10465-PA | 1..133 | 1..133 | 677 | 94 | Plus |
Translation from 88 to 489
> RE49709.hyp MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLG YTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFC RCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cisd2-PA | 133 | CG1458-PA | 1..133 | 1..133 | 733 | 100 | Plus |