Clone RE49709 Report

Search the DGRC for RE49709

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:497
Well:9
Vector:pFlc-1
Associated Gene/TranscriptCisd2-RA
Protein status:RE49709.pep: gold
Sequenced Size:685

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1458 2002-01-01 Sim4 clustering to Release 2
CG1458 2002-04-04 Blastp of sequenced clone
CG1458 2003-01-01 Sim4 clustering to Release 3
CG1458 2008-04-29 Release 5.5 accounting
CG1458 2008-08-15 Release 5.9 accounting
CG1458 2008-12-18 5.12 accounting

Clone Sequence Records

RE49709.complete Sequence

685 bp (685 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095084

> RE49709.complete
ATCGATTTGCTAGCACCGCTAACCGATAGCAACACAAAAACAAGTTTTCC
GAATTTAATAGCCAGTTAAATAAAAAAGGCGTTTCGAAATGGAGCCCATA
TCACATCTGGTGAAGTCCTCGCTGCCCAATTACTTGTCAAGTCTGCCGGT
TCCCGACAGCATCGGCGGCTGGTTTAAGCTCTCCTTCAAGGATTGGTTGG
CCCTGATCCCACCCACCGTGGTGGTGGCCGGACTCGGCTACACCGCCTAC
CTGGCCTACTGTCCGGCGGCACGGGCCAGCTGCGCGGCCAAAAACAGCGG
ACGCTGCAACAACCACATCCGCAAGAACGAGCCCAAGGTGGTGGACATGA
TCGACGTGGAGGATATTGCGGAGAAGGCGGCCTTCTGTCGCTGCTGGAAG
ACCAAGAACTGGCCCTACTGCGATGGCAGTCATGGCGAGCACAACAAGCA
GACTGGAGACAACGTCGGACCAATTGTCATCAAGAAGTAGATTGCGGCGG
TGCATCGATACACAAACGTTCTAGCATTTCCTCTCGCTGAGCTCCAGTTT
GCTTTTAAAACCAATAGTAGTGGCCGAAGCTGTTTGAACCCTTGTAATTG
TAAGCAATAATTGATGATATTGATGGATTAAGTTAAAAGGAGCCAATAAA
ATTGCCCAAACATAAATCCAAAAAAAAAAAAAAAA

RE49709.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1458-RA 789 CG1458-RA 25..696 1..672 3345 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25044983..25045240 667..410 1290 100 Minus
chr3R 27901430 chr3R 25045305..25045528 409..186 1120 100 Minus
chr3R 27901430 chr3R 25046002..25046186 185..1 925 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29222219..29222481 672..410 1300 99.6 Minus
3R 32079331 3R 29222546..29222769 409..186 1120 100 Minus
3R 32079331 3R 29223243..29223427 185..1 925 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28963050..28963312 672..410 1300 99.6 Minus
3R 31820162 3R 28963377..28963600 409..186 1120 100 Minus
3R 31820162 3R 28964074..28964258 185..1 925 100 Minus
Blast to na_te.dros performed 2019-03-15 14:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
pogo 2121 pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). 131..181 640..590 110 73.1 Minus

RE49709.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:23:26 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25044981..25045240 410..669 99 <- Minus
chr3R 25045305..25045528 186..409 100 <- Minus
chr3R 25046002..25046186 1..185 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:19 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..402 89..490 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:14:50 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..402 89..490 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:26:02 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..402 89..490 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:05:49 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..402 89..490 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:56:36 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
Cisd2-RA 1..402 89..490 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:38:06 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..669 1..669 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:14:49 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..669 1..669 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:26:02 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 2..670 1..669 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:05:49 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..669 1..669 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:56:36 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
Cisd2-RA 2..670 1..669 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:26 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29222222..29222481 410..669 99 <- Minus
3R 29222546..29222769 186..409 100 <- Minus
3R 29223243..29223427 1..185 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:26 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29222222..29222481 410..669 99 <- Minus
3R 29222546..29222769 186..409 100 <- Minus
3R 29223243..29223427 1..185 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:26 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29222222..29222481 410..669 99 <- Minus
3R 29222546..29222769 186..409 100 <- Minus
3R 29223243..29223427 1..185 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:26:02 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25047944..25048203 410..669 99 <- Minus
arm_3R 25048268..25048491 186..409 100 <- Minus
arm_3R 25048965..25049149 1..185 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:37:41 Download gff for RE49709.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28963053..28963312 410..669 99 <- Minus
3R 28963377..28963600 186..409 100 <- Minus
3R 28964074..28964258 1..185 100   Minus

RE49709.pep Sequence

Translation from 88 to 489

> RE49709.pep
MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLG
YTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFC
RCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK*

RE49709.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16608-PA 134 GF16608-PA 1..133 1..133 621 82.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12028-PA 133 GG12028-PA 1..133 1..133 682 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14305-PA 132 GH14305-PA 1..130 1..133 621 88 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Cisd2-PA 133 CG1458-PA 1..133 1..133 733 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10402-PA 131 GI10402-PA 1..130 1..133 566 78.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13882-PA 132 GL13882-PA 1..131 1..133 627 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13095-PA 132 GA13095-PA 1..131 1..133 627 86.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12252-PA 133 GM12252-PA 1..133 1..133 690 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17906-PA 133 GD17906-PA 1..133 1..133 690 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14516-PA 133 GJ14516-PA 1..132 1..133 536 72.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22673-PA 134 GK22673-PA 1..134 1..133 628 85.8 Plus
Dwil\GK20216-PA 152 GK20216-PA 1..133 1..132 567 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10465-PA 133 GE10465-PA 1..133 1..133 677 94 Plus

RE49709.hyp Sequence

Translation from 88 to 489

> RE49709.hyp
MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLG
YTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFC
RCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK*

RE49709.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cisd2-PA 133 CG1458-PA 1..133 1..133 733 100 Plus