BDGP Sequence Production Resources |
Search the DGRC for RE49852
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 498 |
Well: | 52 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL23-RA |
Protein status: | RE49852.pep: gold |
Preliminary Size: | 453 |
Sequenced Size: | 563 |
Gene | Date | Evidence |
---|---|---|
CG1320 | 2001-12-14 | Blastp of sequenced clone |
CG1320 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1320 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL23 | 2008-04-29 | Release 5.5 accounting |
mRpL23 | 2008-08-15 | Release 5.9 accounting |
mRpL23 | 2008-12-18 | 5.12 accounting |
563 bp (563 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071415
> RE49852.complete GAATTAGAATCTTAGATCCTGGCTAGATCATGTCCACGAGGTGGTATCCC ATCTATCAGCGCGGCAATCCGCAGCTTCGCGTTTTCCTTCCCAACTTCTG GATGAAGCTAATCCGACCCACGGAGGAACAGCCACCCAATGTGGTCACTT TTTCGGTGTCCATGGAAATGACCAAGTACGATGTGCGTAACTATCTGGAG AAGATCTACAAGCTGCCGGTGGTGGATGTGCGTACTCGGATTGCCATGGG CGAGACCAAGAAGGATCAGACCTACGGCTACATCACCAAAAAAGACGACG TGAAGCTGGCTTATGTAACATTGCCCAGGGAGGAGTCCTTTGTCTTCCCC GACTTCTTTTCCGAAAAGGCTGAGAAGCAGGCCAAGGAGGAAAAGTCGCT GGATGAATCGAAAGCCGGTTTCCGCAGATTTCTGGACAGGAACAAGAAGC GACCCGGCACGCCGGGCTGGTTTTCCATTTAGTTTTTAGTGTGTAATCGT AGTACTTTTCGTTTCAACGGGTAAATAAACATTTATTTCGAAAGTCCAAA AAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 2372277..2372500 | 324..547 | 99 | <- | Minus |
chr3L | 2372562..2372884 | 1..323 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RB | 1..453 | 30..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RB | 1..453 | 30..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RB | 1..453 | 30..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RB | 1..453 | 30..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RB | 1..453 | 30..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RA | 49..595 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RA | 49..595 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RA | 51..597 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RA | 49..595 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL23-RA | 51..597 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2372844..2373067 | 324..547 | 100 | <- | Minus |
3L | 2373129..2373451 | 1..323 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2372844..2373067 | 324..547 | 100 | <- | Minus |
3L | 2373129..2373451 | 1..323 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2372844..2373067 | 324..547 | 100 | <- | Minus |
3L | 2373129..2373451 | 1..323 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 2372844..2373067 | 324..547 | 100 | <- | Minus |
arm_3L | 2373129..2373451 | 1..323 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2372844..2373067 | 324..547 | 100 | <- | Minus |
3L | 2373129..2373451 | 1..323 | 100 | Minus |
Translation from 29 to 481
> RE49852.hyp MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKY DVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKKDDVKLAYVTLPR EESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFLDRNKKRPGTPGWFSI *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL23-PD | 150 | CG1320-PD | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PC | 150 | CG1320-PC | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PB | 150 | CG1320-PB | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PA | 150 | CG1320-PA | 1..150 | 1..150 | 796 | 100 | Plus |
Translation from 29 to 481
> RE49852.pep MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKY DVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKKDDVKLAYVTLPR EESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFLDRNKKRPGTPGWFSI *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24868-PA | 150 | GF24868-PA | 1..150 | 1..150 | 740 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14520-PA | 150 | GG14520-PA | 1..150 | 1..150 | 774 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15005-PA | 150 | GH15005-PA | 1..150 | 1..150 | 688 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL23-PD | 150 | CG1320-PD | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PC | 150 | CG1320-PC | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PB | 150 | CG1320-PB | 1..150 | 1..150 | 796 | 100 | Plus |
mRpL23-PA | 150 | CG1320-PA | 1..150 | 1..150 | 796 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13167-PA | 150 | GI13167-PA | 1..150 | 1..150 | 664 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24615-PA | 150 | GL24615-PA | 1..150 | 1..150 | 627 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12114-PA | 150 | GA12114-PA | 1..150 | 1..150 | 624 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14124-PA | 150 | GM14124-PA | 1..150 | 1..150 | 783 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13394-PA | 150 | GD13394-PA | 1..150 | 1..150 | 779 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11942-PA | 150 | GJ11942-PA | 1..150 | 1..150 | 704 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12514-PA | 150 | GK12514-PA | 1..150 | 1..150 | 685 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21711-PA | 150 | GE21711-PA | 1..150 | 1..150 | 777 | 98 | Plus |