Clone RE49852 Report

Search the DGRC for RE49852

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:498
Well:52
Vector:pFlc-1
Associated Gene/TranscriptmRpL23-RA
Protein status:RE49852.pep: gold
Preliminary Size:453
Sequenced Size:563

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1320 2001-12-14 Blastp of sequenced clone
CG1320 2002-01-01 Sim4 clustering to Release 2
CG1320 2003-01-01 Sim4 clustering to Release 3
mRpL23 2008-04-29 Release 5.5 accounting
mRpL23 2008-08-15 Release 5.9 accounting
mRpL23 2008-12-18 5.12 accounting

Clone Sequence Records

RE49852.complete Sequence

563 bp (563 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071415

> RE49852.complete
GAATTAGAATCTTAGATCCTGGCTAGATCATGTCCACGAGGTGGTATCCC
ATCTATCAGCGCGGCAATCCGCAGCTTCGCGTTTTCCTTCCCAACTTCTG
GATGAAGCTAATCCGACCCACGGAGGAACAGCCACCCAATGTGGTCACTT
TTTCGGTGTCCATGGAAATGACCAAGTACGATGTGCGTAACTATCTGGAG
AAGATCTACAAGCTGCCGGTGGTGGATGTGCGTACTCGGATTGCCATGGG
CGAGACCAAGAAGGATCAGACCTACGGCTACATCACCAAAAAAGACGACG
TGAAGCTGGCTTATGTAACATTGCCCAGGGAGGAGTCCTTTGTCTTCCCC
GACTTCTTTTCCGAAAAGGCTGAGAAGCAGGCCAAGGAGGAAAAGTCGCT
GGATGAATCGAAAGCCGGTTTCCGCAGATTTCTGGACAGGAACAAGAAGC
GACCCGGCACGCCGGGCTGGTTTTCCATTTAGTTTTTAGTGTGTAATCGT
AGTACTTTTCGTTTCAACGGGTAAATAAACATTTATTTCGAAAGTCCAAA
AAAAAAAAAAAAA

RE49852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL23-RA 667 mRpL23-RA 75..621 1..547 2735 100 Plus
mRpL23.a 573 mRpL23.a 29..571 5..547 2715 100 Plus
mRpL23-RB 632 mRpL23-RB 83..622 8..547 2700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2372562..2372884 323..1 1585 99.4 Minus
chr3L 24539361 chr3L 2372277..2372501 547..323 1095 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2373129..2373451 323..1 1615 100 Minus
3L 28110227 3L 2372844..2373068 547..323 1125 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2373129..2373451 323..1 1615 100 Minus
3L 28103327 3L 2372844..2373068 547..323 1125 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:22:37 has no hits.

RE49852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:23:29 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2372277..2372500 324..547 99 <- Minus
chr3L 2372562..2372884 1..323 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:24 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RB 1..453 30..482 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:42 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RB 1..453 30..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:26:12 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RB 1..453 30..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:17 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RB 1..453 30..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:56:42 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RB 1..453 30..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:11 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RA 49..595 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:42 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RA 49..595 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:26:12 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RA 51..597 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:17 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RA 49..595 1..547 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:56:42 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL23-RA 51..597 1..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:29 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372844..2373067 324..547 100 <- Minus
3L 2373129..2373451 1..323 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:29 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372844..2373067 324..547 100 <- Minus
3L 2373129..2373451 1..323 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:29 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372844..2373067 324..547 100 <- Minus
3L 2373129..2373451 1..323 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:26:12 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2372844..2373067 324..547 100 <- Minus
arm_3L 2373129..2373451 1..323 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:15 Download gff for RE49852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372844..2373067 324..547 100 <- Minus
3L 2373129..2373451 1..323 100   Minus

RE49852.hyp Sequence

Translation from 29 to 481

> RE49852.hyp
MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKY
DVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKKDDVKLAYVTLPR
EESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFLDRNKKRPGTPGWFSI
*

RE49852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL23-PD 150 CG1320-PD 1..150 1..150 796 100 Plus
mRpL23-PC 150 CG1320-PC 1..150 1..150 796 100 Plus
mRpL23-PB 150 CG1320-PB 1..150 1..150 796 100 Plus
mRpL23-PA 150 CG1320-PA 1..150 1..150 796 100 Plus

RE49852.pep Sequence

Translation from 29 to 481

> RE49852.pep
MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKY
DVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKKDDVKLAYVTLPR
EESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFLDRNKKRPGTPGWFSI
*

RE49852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24868-PA 150 GF24868-PA 1..150 1..150 740 89.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14520-PA 150 GG14520-PA 1..150 1..150 774 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15005-PA 150 GH15005-PA 1..150 1..150 688 82.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL23-PD 150 CG1320-PD 1..150 1..150 796 100 Plus
mRpL23-PC 150 CG1320-PC 1..150 1..150 796 100 Plus
mRpL23-PB 150 CG1320-PB 1..150 1..150 796 100 Plus
mRpL23-PA 150 CG1320-PA 1..150 1..150 796 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13167-PA 150 GI13167-PA 1..150 1..150 664 87.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24615-PA 150 GL24615-PA 1..150 1..150 627 80.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12114-PA 150 GA12114-PA 1..150 1..150 624 80.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14124-PA 150 GM14124-PA 1..150 1..150 783 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13394-PA 150 GD13394-PA 1..150 1..150 779 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11942-PA 150 GJ11942-PA 1..150 1..150 704 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12514-PA 150 GK12514-PA 1..150 1..150 685 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21711-PA 150 GE21711-PA 1..150 1..150 777 98 Plus